Overview

  • Product name

  • Description

    Rabbit polyclonal to EDA2R/XEDAR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within EDA2R/XEDAR aa 80-138 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    NAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAFQLSLVEADT PTVPPQEAT


    Database link: Q9HAV5

  • Positive control

    • Human gastric carcinoma tissue.
  • General notes

     This product was previously labelled as EDA2R

     

Properties

Applications

Our Abpromise guarantee covers the use of ab203667 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 using a fluorescent secondary antibody).

WB 1/100 - 1/1000. Predicted molecular weight: 33 kDa.

Target

  • Function

    Receptor for EDA isoform A2, but not for EDA isoform A1. Mediates the activation of the NF-kappa-B and JNK pathways. Activation seems to be mediated by binding to TRAF3 and TRAF6.
  • Sequence similarities

    Contains 3 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 9430060M22Rik antibody
    • Ectodysplasin A2 isoform receptor antibody
    • Ectodysplasin A2 receptor antibody
    • EDA A2R antibody
    • EDA-A2 receptor antibody
    • EDA2R antibody
    • EDAA2R antibody
    • MGC124099 antibody
    • OTTMUSP00000019574 antibody
    • OTTMUSP00000019575 antibody
    • RP23-188N15.1 antibody
    • TNFRSF27 antibody
    • TNR27_HUMAN antibody
    • Tumor necrosis factor receptor superfamily member 27 antibody
    • Tumor necrosis factor receptor superfamily member XEDAR antibody
    • X linked ectodysplasin A2 receptor antibody
    • X linked ectodysplasin receptor antibody
    • X-linked ectodysplasin-A2 receptor antibody
    • XEDAR antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human gastric carcinoma tissue labeling EDA2R/XEDAR with ab203667 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203667 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203667.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up