Overview

  • Product name

  • Description

    Rabbit polyclonal to EDAR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human EDAR aa 27-170.
    Sequence:

    EYSNCGENEYYNQTTGLCQECPPCGPGEEPYLSCGYGTKDEDYGCVPCPA EKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENR PRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSP


    Database link: Q9UNE0

  • Positive control

    • WB: A549 whole cell lysate. IHC-P: Human liver cancer and bladder cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235106 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/300 - 1/500.
WB 1/500 - 1/5000. Detects a band of approximately 49 kDa (predicted molecular weight: 49 kDa).

Target

  • Function

    Receptor for EDA isoform A1, but not for EDA isoform A2. Mediates the activation of NF-kappa-B and JNK. May promote caspase-independent cell death.
  • Tissue specificity

    Detected in fetal kidney, lung, skin and cultured neonatal epidermal keratinocytes. Not detected in lymphoblast and fibroblast cell lines.
  • Involvement in disease

    Defects in EDAR are a cause of ectodermal dysplasia anhidrotic (EDA) [MIM:224900]; also known ectodermal dysplasia hypohidrotic autosomal recessive (HED). Ectodermal dysplasia defines a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. EDA is characterized by sparse hair (atrichosis or hypotrichosis), abnormal or missing teeth and the inability to sweat due to the absence of sweat glands.
    Defects in EDAR are the cause of ectodermal dysplasia type 3 (ED3) [MIM:129490]; also known as ectodermal dysplasia hypohidrotic autosomal dominant or EDA3. ED3 is an autosomal dominant condition characterized by hypotrichosis, abnormal or missing teeth, and hypohidrosis due to the absence of sweat glands.
  • Sequence similarities

    Contains 1 death domain.
    Contains 3 TNFR-Cys repeats.
  • Developmental stage

    Found in craniofacial tissues from embryonic day 42-53. Expressed in fetal skin 11 and 15 weeks after gestation.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Anhidrotic ectodysplasin receptor 1 antibody
    • DL antibody
    • Downless (mouse) homolog antibody
    • Downless homolog antibody
    • Downless mouse homolog of antibody
    • ECTD10A antibody
    • ECTD10B antibody
    • Ectodermal dysplasia receptor antibody
    • Ectodysplasin 1 anhidrotic receptor antibody
    • Ectodysplasin A receptor antibody
    • Ectodysplasin A1 isoform receptor antibody
    • Ectodysplasin-A receptor antibody
    • ED 1R antibody
    • ED 3 antibody
    • ED 5 antibody
    • ED1R antibody
    • ED3 antibody
    • ED5 antibody
    • EDA 1R antibody
    • EDA 3 antibody
    • EDA A1 receptor antibody
    • EDA A1R antibody
    • EDA-A1 receptor antibody
    • EDA1R antibody
    • EDA3 antibody
    • Edar antibody
    • EDAR_HUMAN antibody
    • HRM1 antibody
    • Tumor necrosis factor receptor superfamily member EDAR antibody
    see all

Images

  • Anti-EDAR antibody (ab235106) at 1/500 dilution + A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 49 kDa
    Observed band size: 49 kDa

  • Paraffin-embedded human liver cancer tissue stained for EDAR using ab235106 at 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • Paraffin-embedded human bladder cancer tissue stained for EDAR using ab235106 at 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

References

ab235106 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235106.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up