Overview

  • Product name

    Anti-EDDM3B/HE3B antibody
  • Description

    Rabbit polyclonal to EDDM3B/HE3B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human EDDM3B/HE3B aa 27-147.
    Sequence:

    EVSWREFMKQHYLSPSREFREYKCDVLMRENEALKDKSSHMFIYISWYKI EHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSFNYIE FH CSMDGYVDSIEDLKMVEPIGN


    Database link: P56851

  • Positive control

    • IHC-P: Human epididymis tissue.
  • General notes

     This product was previously labelled as EDDM3B

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab121134 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Possible function in sperm maturation.
  • Tissue specificity

    Epididymis.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • EDDM3B antibody
    • EP3B_HUMAN antibody
    • Epididymal secretory protein E3 beta antibody
    • Epididymal secretory protein E3-beta antibody
    • FAM12B antibody
    • Family with sequence similarity 12, member B (epididymal) antibody
    • HE3-beta antibody
    • HE3B antibody
    • Human epididymis-specific protein 3-beta antibody
    • UNQ6412/PRO21187 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded human epididymis tissue staining EDDM3B/HE3B with ab121134 at 1/1000 dilution. 

References

This product has been referenced in:

  • Bu Q  et al. CREB Signaling Is Involved in Rett Syndrome Pathogenesis. J Neurosci 37:3671-3685 (2017). Functional Studies ; Human . Read more (PubMed: 28270572) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab121134.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up