Overview

  • Product name

  • Description

    Rabbit polyclonal to EDEM1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human EDEM1 aa 150-195. The exact sequence is proprietary.
    Sequence:

    FPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAI


    Database link: Q92611

  • Positive control

    • HEK293T, PC12 and Raw264.7 whole cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.097% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab200645 was purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity is > 95% (by SDS-PAGE).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab200645 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 74 kDa.

Target

  • Relevance

    EDEM1 is directly involved in ER associated degradation (ERAD), and targets misfolded glycoproteins for degradation in an N glycan dependent manner. It lacks mannosidase activity. EDEM1 belongs to the glycosyl hydrolase 47 family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Database links

  • Alternative names

    • EDEM 1 antibody
    • EDEM antibody
    • Endoplasmic reticulum degradation enhancing alpha mannosidase like protein antibody
    • ER degradation enhancer, mannosidase alpha like 1 antibody
    • ER degradation enhancing alpha mannosidase like 1 antibody
    • ER degradation enhancing alpha-mannosidase like protein 1 antibody
    • KIAA0212 antibody
    see all

Images

  • All lanes : Anti-EDEM1 antibody (ab200645)

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : Raw264.7 whole cell lysate
    Lane 3 : PC12 whole cell lysate

    Predicted band size: 74 kDa

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200645.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up