Overview

  • Product name

  • Description

    Rabbit polyclonal to EDEM2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human EDEM2 aa 441-537.
    Sequence:

    FDPTNFIHNNGSTFDAVITPYGECILGAGGYIFNTEAHPIDPAALHCCQR LKEEQWEVEDLMREFYSLKRSRSKFQKNTVSSGPWEPPARPGTLFSP


    Database link: Q9BV94

  • Positive control

    • Human small intestine tissue; RT-4 and U-251 MG cell lysates; Human plasma.
  • General notes

     This product was previously labelled as C20orf31

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204173 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 65 kDa.

Target

  • Function

    Involved in endoplasmic reticulum-associated degradation (ERAD) that targets misfolded glycoproteins for degradation in an N-glycan-dependent manner. It lacks mannosidase activity. Extracts misfolded glycoproteins, but not glycoproteins undergoing productive folding, from the calnexin cycle.
  • Tissue specificity

    Expressed ubiquitously in all tissues tested with slightly higher levels detected in small intestine and peripheral blood leukocytes and weakest levels in brain and skeletal muscle.
  • Sequence similarities

    Belongs to the glycosyl hydrolase 47 family.
  • Post-translational
    modifications

    Glycosylated.
  • Cellular localization

    Secreted. Endoplasmic reticulum lumen.
  • Information by UniProt
  • Database links

  • Alternative names

    • bA4204.1 antibody
    • C20orf31 antibody
    • C20orf49 antibody
    • EDEM 2 antibody
    • EDEM2 antibody
    • EDEM2_HUMAN antibody
    • ER degradation enhancer mannosidase alpha like 2 antibody
    • ER degradation enhancing alpha mannosidase like 2 antibody
    • ER degradation enhancing alpha mannosidase like protein 2 antibody
    • ER degradation enhancing mannosidase like protein 2 antibody
    • ER degradation-enhancing alpha-mannosidase-like 2 antibody
    • FLJ10783 antibody
    • UNQ573/PRO1135 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human small intestine labeling EDEM2 with ab204173 at 1/20 dilution.

  • All lanes : Anti-EDEM2 antibody (ab204173) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma

    Predicted band size: 65 kDa

References

ab204173 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204173.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up