Overview

  • Product name
  • Description
    Rabbit polyclonal to EDF1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IP, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Synthetic peptide within Human EDF1 aa 98-148. The exact sequence is proprietary. NP_003783.1.
    Sequence:

    KINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRA K


    Database link: O60869

  • Positive control
    • 293T, HeLa, and Jurkat whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab174651 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/2000 - 1/10000. Predicted molecular weight: 16 kDa.

Target

  • Function
    Transcriptional coactivator stimulating NR5A1 and ligand-dependent NR1H3/LXRA and PPARG transcriptional activities. Enhances the DNA-binding activity of ATF1, ATF2, CREB1 and NR5A1. Regulates nitric oxid synthase activity probably by sequestering calmodulin in the cytoplasm. May function in endothelial cells differentiation, hormone-induced cardiomyocytes hypertrophy and lipid metabolism.
  • Tissue specificity
    Expressed in brain, liver, lung, kidney and heart (at protein level). Ubiquitously expressed. More abundant in heart, pancreas, liver, intestine and adipose tissues.
  • Sequence similarities
    Contains 1 HTH cro/C1-type DNA-binding domain.
  • Developmental stage
    Expressed in fetal tissues. More abundant in kidney.
  • Domain
    The IQ motif, which is involved in calmodulin binding, overlaps with the binding domain for nuclear receptors and transcription factors. Its phosphorylation probably allows a switch between the two activities of the protein.
  • Post-translational
    modifications
    Phosphorylated (by PKA and PKC).
  • Cellular localization
    Cytoplasm. Nucleus. Also nuclear upon binding to NR5A1 and treatment of cells with TPA or forskolin.
  • Information by UniProt
  • Database links
  • Alternative names
    • CAP19 antibody
    • EDF-1 antibody
    • edf1 antibody
    • EDF1_HUMAN antibody
    • Endothelial differentiation related factor 1 antibody
    • Endothelial differentiation-related factor 1 antibody
    • MBF1 antibody
    • MGC9058 antibody
    • Multiprotein bridging factor 1 antibody
    • Multiprotein-bridging factor 1 antibody
    see all

Images

  • All lanes : Anti-EDF1 antibody (ab174651) at 0.100000001490116 µg/ml

    Lane 1 : 293T whole cell lysate
    Lane 2 : HeLa whole cell lysate
    Lane 3 : Jurkat whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 16 kDa


    Exposure time: 3 minutes
  • Detection of EDF1 in Immunoprecipitates of 293T whole cell lysates (1 mg for IP, 20% of IP loaded) using ab174651 at 6 µg/mg lysate for IP (Lane 1). For WB detection ab174651 was used at 1 µg/ml. Lane 2 represents control IgG IP. 

References

This product has been referenced in:
  • Nishioka K  et al. Mbf1 ensures Polycomb silencing by protecting E(z) mRNA from degradation by Pacman. Development 145:N/A (2018). Read more (PubMed: 29523653) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174651.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up