Overview

  • Product name

  • Description

    Rabbit polyclonal to EDG8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Human EDG8 aa 1-40 (N terminal) conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADA


    Database link: Q9H228

  • Positive control

    • Rat spleen tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab214464 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/300.
Flow Cyt 1/50.

Target

  • Function

    Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. Is coupled to both the G(i/0)alpha and G(12) subclass of heteromeric G-proteins (By similarity). May play a regulatory role in the transformation of radial glial cells into astrocytes and may affect proliferative activity of these cells.
  • Tissue specificity

    Widely expressed in the brain, most prominently in the corpus callosum, which is predominantly white matter. Detected in spleen, peripheral blood leukocytes, placenta, lung, aorta and fetal spleen. Low-level signal detected in many tissue extracts. Overexpressed in leukemic large granular lymphocytes. Isoform 1 is predominantly expressed in peripheral tissues. Isoform 2 is expressed in brain, spleen and peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Developmental stage

    At 24 weeks of gestation, fragments of radial glial fibers are positive within the cortical plate and subplate of allocortical areas. These positive fragments often appear enlarged as varicosities and some of them terminate at blood vessels. Between 28 and 30 weeks of gestation, all iso- and allocortical areas contain immunolabelled radial glial fibers revealing curvature next to sulci. After 32 weeks of gestation, radial glial fibers gradually disappear; instead positive transitional stages between radial glia and astrocytes were found.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • EDG 8 antibody
    • EDG8 S1P receptor antibody
    • Endothelial differentiation G protein coupled receptor 8 antibody
    • Endothelial differentiation G-protein-coupled receptor 8 antibody
    • Endothelial Differentiation Gene 8 antibody
    • Endothelial differentiation sphingolipid G protein coupled receptor 8 antibody
    • S1P receptor 5 antibody
    • S1P receptor Edg 8 antibody
    • S1P receptor Edg-8 antibody
    • S1P receptor Edg8 antibody
    • S1P5 antibody
    • S1PR5 antibody
    • S1PR5_HUMAN antibody
    • Sphingosine 1 Phosphate Receptor 5 antibody
    • Sphingosine 1 phosphate receptor Edg 8 antibody
    • Sphingosine 1 phosphate receptor Edg8 antibody
    • Sphingosine 1-phosphate receptor 5 antibody
    • Sphingosine 1-phosphate receptor Edg-8 antibody
    • SPPR 1 antibody
    • SPPR 2 antibody
    • SPPR1 antibody
    • SPPR2 antibody
    see all

Images

  • Flow Cytometry of Mouse Spleen with ab203037 at 1/50
  • Anti-EDG8 antibody (ab214464) at 1/300 dilution + Mouse brain

    Secondary
    Conjugated secondary antibody at 1/20000 dilution
  • Immunohistochemical analysis of paraformaldehyde-fixed, paraffin-embedded rat spleen tissue labeling EDG8 with ab214464 at 1/400 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab214464 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214464.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up