Anti-EDIL3/DEL1 antibody (ab88667)
Key features and details
- Mouse monoclonal to EDIL3/DEL1
- Suitable for: WB
- Reacts with: Human, Recombinant fragment
- Isotype: IgG2a
Overview
-
Product name
Anti-EDIL3/DEL1 antibody
See all EDIL3/DEL1 primary antibodies -
Description
Mouse monoclonal to EDIL3/DEL1 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human, Recombinant fragment
Predicted to work with: Mouse, Xenopus laevis, Zebrafish, Orangutan -
Immunogen
Recombinant fragment corresponding to Human EDIL3/DEL1 aa 101-199.
Sequence:IGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFM GRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKK
Database link: NP_005702 -
Positive control
- Partial tagged recombinant Human EDIL3/DEL1 protein (the immunogen). Human pancreas tissue lysate.
-
General notes
This product was changed from ascites to tissue culture supernatant on 30th April 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
Previously labelled as EDIL3.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.4
Constituent: 2.68% PBS -
Concentration information loading...
-
Purity
Tissue culture supernatant -
Purification notes
Purified from TCS. -
Clonality
Monoclonal -
Isotype
IgG2a -
Light chain type
kappa -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab88667 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (2) |
Use at an assay dependent concentration. Predicted molecular weight: 54 kDa.
|
Notes |
---|
WB
Use at an assay dependent concentration. Predicted molecular weight: 54 kDa. |
Target
-
Function
Promotes adhesion of endothelial cells through interaction with the alpha-v/beta-3 integrin receptor. Inhibits formation of vascular-like structures. May be involved in regulation of vascular morphogenesis of remodeling in embryonic development. -
Sequence similarities
Contains 3 EGF-like domains.
Contains 2 F5/8 type C domains. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 10085 Human
- Entrez Gene: 13612 Mouse
- Entrez Gene: 100173296 Orangutan
- Entrez Gene: 403365 Xenopus laevis
- Omim: 606018 Human
- SwissProt: O43854 Human
- SwissProt: O35474 Mouse
- SwissProt: Q5R7K9 Orangutan
see all -
Alternative names
- DEL1 antibody
- Developmental endothelial locus 1 antibody
- Developmentally regulated endothelial cell locus 1 protein antibody
see all
Images
-
Anti-EDIL3/DEL1 antibody (ab88667) at 5 µg/ml + Partial tagged recombinant human EDIL3/DEL1 protein (the immunogen) at 0.2 µg
Predicted band size: 54 kDa
Observed band size: 37 kDa why is the actual band size different from the predicted?Western blot against tagged recombinant protein immunogen. Predicted band size of immunogen is 37 kDa.
This image was generated using the ascites version of the product.
-
Anti-EDIL3/DEL1 antibody (ab88667) at 5 µg/ml + human pancreas tissue lysate at 50 µg
Predicted band size: 54 kDa
Observed band size: 54 kDaThis image was generated using the ascites version of the product.
Datasheets and documents
-
SDS download
-
Datasheet download
References (2)
ab88667 has been referenced in 2 publications.
- Im EJ et al. Sulfisoxazole inhibits the secretion of small extracellular vesicles by targeting the endothelin receptor A. Nat Commun 10:1387 (2019). PubMed: 30918259
- Moon PG et al. Identification of Developmental Endothelial Locus-1 on Circulating Extracellular Vesicles as a Novel Biomarker for Early Breast Cancer Detection. Clin Cancer Res 22:1757-66 (2016). PubMed: 26603257