Overview

  • Product name

  • Description

    Mouse monoclonal to EDIL3/DEL1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Xenopus laevis, Zebrafish, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human EDIL3/DEL1 aa 101-199.
    Sequence:

    IGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFM GRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKK


    Database link: NP_005702

  • Positive control

    • Partial tagged recombinant Human EDIL3/DEL1 protein (the immunogen). Human pancreas tissue lysate.
  • General notes

    This product was changed from ascites to tissue culture supernatant on 30th April 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

    Previously labelled as EDIL3. 

Properties

Applications

Our Abpromise guarantee covers the use of ab88667 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 54 kDa.
ELISA Use at an assay dependent concentration.

Target

  • Function

    Promotes adhesion of endothelial cells through interaction with the alpha-v/beta-3 integrin receptor. Inhibits formation of vascular-like structures. May be involved in regulation of vascular morphogenesis of remodeling in embryonic development.
  • Sequence similarities

    Contains 3 EGF-like domains.
    Contains 2 F5/8 type C domains.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • DEL1 antibody
    • Developmental endothelial locus 1 antibody
    • Developmentally regulated endothelial cell locus 1 protein antibody
    • Developmentally-regulated endothelial cell locus 1 protein antibody
    • Edil3 antibody
    • EDIL3_HUMAN antibody
    • EGF like repeat and discoidin I like domain containing protein 3 antibody
    • EGF like repeats and discoidin I like domains 3 antibody
    • EGF like repeats and discoidin I like domains protein 3 antibody
    • EGF-like repeat and discoidin I-like domain-containing protein 3 antibody
    • Integrin binding protein DEL1 antibody
    • Integrin-binding protein DEL1 antibody
    see all

Images

  • Anti-EDIL3/DEL1 antibody (ab88667) at 5 µg/ml + Partial tagged recombinant human EDIL3/DEL1 protein (the immunogen) at 0.2 µg

    Predicted band size: 54 kDa
    Observed band size: 37 kDa
    why is the actual band size different from the predicted?



    Western blot against tagged recombinant protein immunogen. Predicted band size of immunogen is 37 kDa.

    This image was generated using the ascites version of the product.

  • Anti-EDIL3/DEL1 antibody (ab88667) at 5 µg/ml + human pancreas tissue lysate at 50 µg

    Predicted band size: 54 kDa
    Observed band size: 54 kDa



    This image was generated using the ascites version of the product.

References

This product has been referenced in:

  • Im EJ  et al. Sulfisoxazole inhibits the secretion of small extracellular vesicles by targeting the endothelin receptor A. Nat Commun 10:1387 (2019). Read more (PubMed: 30918259) »
  • Moon PG  et al. Identification of Developmental Endothelial Locus-1 on Circulating Extracellular Vesicles as a Novel Biomarker for Early Breast Cancer Detection. Clin Cancer Res 22:1757-66 (2016). Read more (PubMed: 26603257) »
See all 2 Publications for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Western blot
Sample
Sheep Serum (Seminal plasma and exosomes)
Gel Running Conditions
Reduced Denaturing
Loading amount
10 µg
Specification
Seminal plasma and exosomes
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 4°C

Tamara Leahy

Verified customer

Submitted Apr 20 2017

Application
Western blot
Sample
Mouse Tissue lysate - whole (Lung)
Gel Running Conditions
Reduced Denaturing
Loading amount
30 µg
Specification
Lung
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C

Abcam user community

Verified customer

Submitted Jan 30 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up