For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    edil3del1-antibody-ab88667.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Cytoskeleton / ECM Cell Adhesion Cell Adhesion Molecules Endothelial
Share by email

Anti-EDIL3/DEL1 antibody (ab88667)

  • Datasheet
  • SDS
Reviews (2) Submit a question References (2)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-EDIL3/DEL1 antibody (ab88667)
  • Western blot - Anti-EDIL3/DEL1 antibody (ab88667)

Key features and details

  • Mouse monoclonal to EDIL3/DEL1
  • Suitable for: WB
  • Reacts with: Human, Recombinant fragment
  • Isotype: IgG2a

You may also be interested in

Protein
Product image
Recombinant Human EDIL3/DEL1 protein (His tag) (ab204774)
Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)

View more associated products

Overview

  • Product name

    Anti-EDIL3/DEL1 antibody
    See all EDIL3/DEL1 primary antibodies
  • Description

    Mouse monoclonal to EDIL3/DEL1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human, Recombinant fragment
    Predicted to work with: Mouse, Xenopus laevis, Zebrafish, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human EDIL3/DEL1 aa 101-199.
    Sequence:

    IGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFM GRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKK


    Database link: NP_005702
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Partial tagged recombinant Human EDIL3/DEL1 protein (the immunogen). Human pancreas tissue lysate.
  • General notes

    This product was changed from ascites to tissue culture supernatant on 30th April 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

    Previously labelled as EDIL3. 

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.4
    Constituent: 2.68% PBS
  • Concentration information loading...
  • Purity

    Tissue culture supernatant
  • Purification notes

    Purified from TCS.
  • Clonality

    Monoclonal
  • Isotype

    IgG2a
  • Light chain type

    kappa
  • Research areas

    • Signal Transduction
    • Cytoskeleton / ECM
    • Cell Adhesion
    • Cell Adhesion Molecules
    • Endothelial
    • Signal Transduction
    • Cytoskeleton / ECM
    • Cell Adhesion
    • Integrins
    • Alpha
    • Signal Transduction
    • Cytoskeleton / ECM
    • Cell Adhesion
    • Integrins
    • Beta
    • Cardiovascular
    • Angiogenesis
    • Angiogenic Factors

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
  • Isotype control

    • Mouse IgG2a, kappa monoclonal [MG2a-53] - Isotype control (ab18415)
  • Recombinant Protein

    • Recombinant Human EDIL3/DEL1 protein (His tag) (ab204774)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab88667 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB (2)
Use at an assay dependent concentration. Predicted molecular weight: 54 kDa.
Notes
WB
Use at an assay dependent concentration. Predicted molecular weight: 54 kDa.

Target

  • Function

    Promotes adhesion of endothelial cells through interaction with the alpha-v/beta-3 integrin receptor. Inhibits formation of vascular-like structures. May be involved in regulation of vascular morphogenesis of remodeling in embryonic development.
  • Sequence similarities

    Contains 3 EGF-like domains.
    Contains 2 F5/8 type C domains.
  • Cellular localization

    Secreted.
  • Target information above from: UniProt accession O43854 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 10085 Human
    • Entrez Gene: 13612 Mouse
    • Entrez Gene: 100173296 Orangutan
    • Entrez Gene: 403365 Xenopus laevis
    • Omim: 606018 Human
    • SwissProt: O43854 Human
    • SwissProt: O35474 Mouse
    • SwissProt: Q5R7K9 Orangutan
    • Unigene: 482730 Human
    • Unigene: 125580 Mouse
    see all
  • Alternative names

    • DEL1 antibody
    • Developmental endothelial locus 1 antibody
    • Developmentally regulated endothelial cell locus 1 protein antibody
    • Developmentally-regulated endothelial cell locus 1 protein antibody
    • Edil3 antibody
    • EDIL3_HUMAN antibody
    • EGF like repeat and discoidin I like domain containing protein 3 antibody
    • EGF like repeats and discoidin I like domains 3 antibody
    • EGF like repeats and discoidin I like domains protein 3 antibody
    • EGF-like repeat and discoidin I-like domain-containing protein 3 antibody
    • Integrin binding protein DEL1 antibody
    • Integrin-binding protein DEL1 antibody
    see all

Images

  • Western blot - Anti-EDIL3/DEL1 antibody (ab88667)
    Western blot - Anti-EDIL3/DEL1 antibody (ab88667)
    Anti-EDIL3/DEL1 antibody (ab88667) at 5 µg/ml + Partial tagged recombinant human EDIL3/DEL1 protein (the immunogen) at 0.2 µg

    Predicted band size: 54 kDa
    Observed band size: 37 kDa why is the actual band size different from the predicted?



    Western blot against tagged recombinant protein immunogen. Predicted band size of immunogen is 37 kDa.

    This image was generated using the ascites version of the product.

  • Western blot - Anti-EDIL3/DEL1 antibody (ab88667)
    Western blot - Anti-EDIL3/DEL1 antibody (ab88667)
    Anti-EDIL3/DEL1 antibody (ab88667) at 5 µg/ml + human pancreas tissue lysate at 50 µg

    Predicted band size: 54 kDa
    Observed band size: 54 kDa



    This image was generated using the ascites version of the product.

Protocols

  • Western blot protocols

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (2)

Publishing research using ab88667? Please let us know so that we can cite the reference in this datasheet.

ab88667 has been referenced in 2 publications.

  • Im EJ  et al. Sulfisoxazole inhibits the secretion of small extracellular vesicles by targeting the endothelin receptor A. Nat Commun 10:1387 (2019). PubMed: 30918259
  • Moon PG  et al. Identification of Developmental Endothelial Locus-1 on Circulating Extracellular Vesicles as a Novel Biomarker for Early Breast Cancer Detection. Clin Cancer Res 22:1757-66 (2016). PubMed: 26603257

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

1-2 of 2 Abreviews or Q&A

Western blot abreview for Anti-EDIL3/DEL1 antibody

Excellent
Abreviews
Abreviews
abreview image
Application
Western blot
Sample
Sheep Serum (Seminal plasma and exosomes)
Gel Running Conditions
Reduced Denaturing
Loading amount
10 µg
Specification
Seminal plasma and exosomes
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 4°C
Read More

Tamara Leahy

Verified customer

Submitted Apr 20 2017

Western blot abreview for Anti-EDIL3/DEL1 antibody

Good
Abreviews
Abreviews
abreview image
Application
Western blot
Sample
Mouse Tissue lysate - whole (Lung)
Gel Running Conditions
Reduced Denaturing
Loading amount
30 µg
Specification
Lung
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C
Read More

Abcam user community

Verified customer

Submitted Jan 30 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2021 Abcam plc. All rights reserved.