Overview

  • Product name

  • Description

    Rabbit polyclonal to EDJ
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Dog, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human EDJ aa 213-356.
    Sequence:

    EPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPIFERRGDDLYTNV TISLVESLVGFEMDITHLDGHKVHISRDKITRPGAKLWKKGEGLPNFDNN NIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKVYNGLQ


    Database link: Q9UBS4

  • Positive control

    • WB: HeLa, NIH/3T3 and NBT-II cell lysate. ICC/IF: U-2 OS cells. IHC-P: Human pancreas tissue.
  • General notes

    Previously labelled as DNAJB11.

Properties

Applications

Our Abpromise guarantee covers the use of ab224082 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 40 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Serves as a co-chaperone for HSPA5. Binds directly to both unfolded proteins that are substrates for ERAD and nascent unfolded peptide chains, but dissociates from the HSPA5-unfolded protein complex before folding is completed. May help recruiting HSPA5 and other chaperones to the substrate. Stimulates HSPA5 ATPase activity.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Contains 1 J domain.
  • Post-translational
    modifications

    Contains high-mannose Endo H-sensitive carbohydrates.
    Cys-169, Cys-171, Cys-193 and Cys-196 form intramolecular disulfide bonds. The preferential partner for each Cys is not known.
    Thr-188 was reported (PubMed:17525332) to be phosphorylated upon DNA damage by ATM or ATR; however as this position has been shown to be in the ER lumen, the in vivo relevance is not proven.
  • Cellular localization

    Endoplasmic reticulum lumen. Associated with the ER membrane in a C-terminally epitope-tagged construct.
  • Information by UniProt
  • Database links

  • Alternative names

    • ABBP-2 antibody
    • ABBP2 antibody
    • APOBEC1 binding protein 2 antibody
    • APOBEC1-binding protein 2 antibody
    • DJ9 antibody
    • DJB11_HUMAN antibody
    • DnaJ (Hsp40) homolog subfamily B member 11 antibody
    • DnaJ homolog subfamily B member 11 antibody
    • DnaJ protein homolog 9 antibody
    • DNAJB11 antibody
    • EDJ antibody
    • ER associated DNAJ antibody
    • ER associated dnaJ protein 3 antibody
    • ER associated Hsp40 co chaperone antibody
    • ER-associated DNAJ antibody
    • ER-associated dnaJ protein 3 antibody
    • ER-associated Hsp40 co-chaperone antibody
    • ERdj3 antibody
    • ERJ3 antibody
    • ERj3p antibody
    • hDj-9 antibody
    • hDj9 antibody
    • HEDJ antibody
    • Human DnaJ protein 9 antibody
    • PWP1 interacting protein 4 antibody
    • PWP1-interacting protein 4 antibody
    see all

Images

  • Anti-EDJ antibody (ab224082) at 1/100 dilution + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 40 kDa

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for EDJ (green) using ab224082 (4 µg/ml) in ICC/IF.

  • Paraffin embedded human pancreas tissue stained for EDJ with ab224082 (1/200 dilution) in immunohistochemical analysis.

  • All lanes : Anti-EDJ antibody (ab224082) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) cell lysate
    Lane 2 : NBT-II (rat cell line) cell lysate

    Predicted band size: 40 kDa

References

ab224082 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224082.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up