Anti-EDR1 / PHC1 antibody (ab222825)
Key features and details
- Rabbit polyclonal to EDR1 / PHC1
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-EDR1 / PHC1 antibody
See all EDR1 / PHC1 primary antibodies -
Description
Rabbit polyclonal to EDR1 / PHC1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse -
Immunogen
Recombinant fragment corresponding to Human EDR1/ PHC1 aa 142-225.
Sequence:LNQSQAQMYLRPQLGNLLQVNRTLGRNVPLASQLILMPNGAVAAVQQEVP SAQSPGVHADADQVQNLAVRNQQASAQGPQMQGS
Database link: P78364 -
Positive control
- IHC-P: Human testis tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab222825 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. |
Target
-
Function
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. -
Sequence similarities
Contains 1 FCS-type zinc finger.
Contains 1 SAM (sterile alpha motif) domain. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 1911 Human
- Entrez Gene: 13619 Mouse
- Omim: 602978 Human
- SwissProt: P78364 Human
- SwissProt: Q64028 Mouse
- Unigene: 305985 Human
- Unigene: 6822 Mouse
-
Alternative names
- Early development regulatory protein 1 antibody
- hPH1 antibody
- mPH1 antibody
see all
Images
References (0)
ab222825 has not yet been referenced specifically in any publications.