Overview

  • Product name

  • Description

    Rabbit polyclonal to EED
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human EED aa 1-300.
    Sequence:

    MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNT ERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQ FNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTC AWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHP RDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEK IMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFS


    Database link: O75530

  • Positive control

    • IHC-P: Human colon cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab236292 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Polycomb group (PcG) protein. Component of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' and 'Lys-27' of histone H3, leading to transcriptional repression of the affected target gene. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1 and CDKN2A.
  • Tissue specificity

    Expressed in brain, colon, heart, kidney, liver, lung, muscle, ovary, peripheral blood leukocytes, pancreas, placenta, prostate, spleen, small intestine, testis, thymus and uterus. Appears to be overexpressed in breast and colon cancer.
  • Sequence similarities

    Belongs to the WD repeat ESC family.
    Contains 7 WD repeats.
  • Developmental stage

    Expression peaks at the G1/S phase boundary.
  • Cellular localization

    Nucleus. Chromosome. Transiently colocalizes with XIST at inactive X chromosomes.
  • Information by UniProt
  • Database links

  • Alternative names

    • eed antibody
    • EED protein antibody
    • EED, mouse, homolog of antibody
    • EED_HUMAN antibody
    • Embryonic ectoderm development antibody
    • Embryonic ectoderm development isoform a antibody
    • Embryonic ECTODERM development protein homolog antibody
    • Embryonic ectoderm development protein, mouse, homolog of antibody
    • hEED antibody
    • OTTHUMP00000235483 antibody
    • OTTHUMP00000235484 antibody
    • OTTHUMP00000235485 antibody
    • Polycomb protein eed antibody
    • WAIT 1 antibody
    • WAIT-1 antibody
    • WAIT1 antibody
    • WD protein associating with integrin cytoplasmic tails 1 antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for EED using ab236292 at 1/100 dilution in immunohistochemical analysis.

References

ab236292 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236292.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up