Overview

  • Product name

    Anti-eEF1A1/EF-Tu antibody
    See all eEF1A1/EF-Tu primary antibodies
  • Description

    Rabbit polyclonal to eEF1A1/EF-Tu
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Rabbit, Horse, Chicken, Cow, Cat, Chimpanzee, Chinese hamster
  • Immunogen

    Recombinant full length protein corresponding to Human eEF1A1/EF-Tu aa 1-462.
    Sequence:

    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMG KGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIK NMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIV GVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDN MLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPL QDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALS EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHP GQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAA IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGK VTKSAQKAQKAK


    Database link: P68104

  • Positive control

    • T470, 293T, MCF7, HeLa, Jurkat, HepG2 and SHSY5Y cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab175274 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
WB 1/500 - 1/2000. Predicted molecular weight: 50 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Function

    This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.
  • Tissue specificity

    Brain, placenta, lung, liver, kidney, pancreas but barely detectable in heart and skeletal muscle.
  • Sequence similarities

    Belongs to the GTP-binding elongation factor family. EF-Tu/EF-1A subfamily.
  • Post-translational
    modifications

    ISGylated.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • CCS 3 antibody
    • CCS3 antibody
    • Cervical cancer suppressor 3 antibody
    • chunp6927 antibody
    • CTCL tumor antigen antibody
    • EE1A1 antibody
    • EEF 1 antibody
    • EEF1A antibody
    • eEF1A-1 antibody
    • EEF1A1 antibody
    • EF-1-alpha-1 antibody
    • EF-Tu antibody
    • EF1A antibody
    • EF1a like protein antibody
    • EF1A1_HUMAN antibody
    • Elongation factor 1 alpha subunit antibody
    • Elongation factor 1-alpha 1 antibody
    • Elongation factor Tu antibody
    • Eukaryotic elongation factor 1 A-1 antibody
    • Eukaryotic translation elongation factor 1 alpha 1 antibody
    • Eukaryotic translation elongation factor 1 alpha 1 like 14 antibody
    • Glucocorticoid receptor AF 1 specific elongation factor antibody
    • GRAF 1EF antibody
    • HNGC:16303 antibody
    • ik:tdsubc_2a3 antibody
    • ik:tdsubc_2b3 antibody
    • LENG7 antibody
    • Leukocyte receptor cluster (LRC) member 7 antibody
    • Leukocyte receptor cluster member 7 antibody
    • Prostate tumor inducing protein 1 antibody
    • PTI1 antibody
    • tdsubc_2a3 antibody
    • Translation elongation factor 1 alpha 1 like 14 antibody
    • wu:fa91c07 antibody
    • wu:fa94b03 antibody
    • wu:fi13b09 antibody
    • xx:tdsubc_2a3 antibody
    • xx:tdsubc_2b3 antibody
    see all

Images

  • All lanes : Anti-eEF1A1/EF-Tu antibody (ab175274) at 1/500 dilution

    Lane 1 : T470 cell lysate
    Lane 2 : 293T cell lysate
    Lane 3 : MCF7 cell lysate
    Lane 4 : HeLa cell lysate
    Lane 5 : Jurkat cell lysate
    Lane 6 : HepG2 cell lysate
    Lane 7 : SHSY5Y cell lysate

    Predicted band size: 50 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat testis tissue labelling eEF1A1/EF-Tu with ab175274 at 1/200. Magnification: 400x.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human stomach cancer tissue labelling eEF1A1/EF-Tu with ab175274 at 1/200. Magnification: 400x.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human rectum tissue labelling eEF1A1/EF-Tu with ab175274 at 1/200. Magnification: 400x.

  • Immunocytochemistry/Immunofluorescence analysis of HeLa cells using ab175274. Blue DAPI for nuclear staining.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175274.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up