Overview

  • Product name

    Anti-eEF1A1/EF-Tu antibody
    See all eEF1A1/EF-Tu primary antibodies
  • Description

    Rabbit polyclonal to eEF1A1/EF-Tu
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit
  • Immunogen

    Recombinant fragment aa 274-322.
    Sequence:

    PGMVVTFAPVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRR


    Database link: Q05639

  • Positive control

    • IHC-P: Human cerebellum tissue. WB: RT-4 and U-251 MG sp cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab212173 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/250 - 1/500.

Target

  • Function

    This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.
  • Tissue specificity

    Brain, placenta, lung, liver, kidney, pancreas but barely detectable in heart and skeletal muscle.
  • Sequence similarities

    Belongs to the GTP-binding elongation factor family. EF-Tu/EF-1A subfamily.
  • Post-translational
    modifications

    ISGylated.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • CCS 3 antibody
    • CCS3 antibody
    • Cervical cancer suppressor 3 antibody
    • chunp6927 antibody
    • CTCL tumor antigen antibody
    • EE1A1 antibody
    • EEF 1 antibody
    • EEF1A antibody
    • eEF1A-1 antibody
    • EEF1A1 antibody
    • EF-1-alpha-1 antibody
    • EF-Tu antibody
    • EF1A antibody
    • EF1a like protein antibody
    • EF1A1_HUMAN antibody
    • Elongation factor 1 alpha subunit antibody
    • Elongation factor 1-alpha 1 antibody
    • Elongation factor Tu antibody
    • Eukaryotic elongation factor 1 A-1 antibody
    • Eukaryotic translation elongation factor 1 alpha 1 antibody
    • Eukaryotic translation elongation factor 1 alpha 1 like 14 antibody
    • Glucocorticoid receptor AF 1 specific elongation factor antibody
    • GRAF 1EF antibody
    • HNGC:16303 antibody
    • ik:tdsubc_2a3 antibody
    • ik:tdsubc_2b3 antibody
    • LENG7 antibody
    • Leukocyte receptor cluster (LRC) member 7 antibody
    • Leukocyte receptor cluster member 7 antibody
    • Prostate tumor inducing protein 1 antibody
    • PTI1 antibody
    • tdsubc_2a3 antibody
    • Translation elongation factor 1 alpha 1 like 14 antibody
    • wu:fa91c07 antibody
    • wu:fa94b03 antibody
    • wu:fi13b09 antibody
    • xx:tdsubc_2a3 antibody
    • xx:tdsubc_2b3 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded human cerebellum tissue sections labelling eEF1A1/EF-Tu with ab212173 at a 1/500 dilution.

  • All lanes : Anti-eEF1A1/EF-Tu antibody (ab212173) at 1/250 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG sp cell lysate

References

ab212173 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Mouse Cell lysate - whole cell (Brain, Skeletal Muscle, Kidney)
Gel Running Conditions
Reduced Denaturing (4-12% Gradient Gel)
Loading amount
20 µg
Specification
Brain, Skeletal Muscle, Kidney
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C

Abcam user community

Verified customer

Submitted Dec 19 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up