Overview

  • Product name

  • Description

    Rabbit polyclonal to EEF1A2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human EEF1A2 aa 228-272.
    Sequence:

    LLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGIL


    Database link: Q05639

  • Positive control

    • RT-4 and U-251 MG sp cell lysates; Human cerebellum tissue and liver cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab212172 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 50 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.
  • Tissue specificity

    Brain, heart, and skeletal muscle.
  • Sequence similarities

    Belongs to the GTP-binding elongation factor family. EF-Tu/EF-1A subfamily.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • eEF1A-2 antibody
    • Eef1a2 antibody
    • EEF1AL antibody
    • EF 1 alpha 2 antibody
    • EF-1-alpha-2 antibody
    • EF1A antibody
    • EF1A2_HUMAN antibody
    • Elongation factor 1 A 2 antibody
    • Elongation factor 1 alpha antibody
    • Elongation factor 1 alpha 2 antibody
    • Elongation factor 1-alpha 2 antibody
    • Eukaryotic elongation factor 1 A-2 antibody
    • Eukaryotic translation elongation factor 1 alpha 2 antibody
    • FLJ41696 antibody
    • HS1 antibody
    • OTTHUMP00000031776 antibody
    • Statin like antibody
    • Statin S1 antibody
    • Statin-S1 antibody
    • STN antibody
    • STNL antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human liver cancer tissue labeling EEF1A2 with ab212172 at 1/50 dilution.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human cerebellum tissue labeling EEF1A2 with ab212172 at 1/50 dilution.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human cerebellum tissue labeling EEF1A2 with ab212172 at 1/50 dilution.

  • All lanes : Anti-EEF1A2 antibody (ab212172) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG sp cell lysate

    Predicted band size: 50 kDa

References

ab212172 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab212172.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up