Overview

  • Product name

    Anti-EEF1A2 antibody - C-terminal
    See all EEF1A2 primary antibodies
  • Description

    Mouse polyclonal to EEF1A2 - C-terminal
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human, Recombinant fragment
    Predicted to work with: Rabbit, Chicken, Cow, Zebrafish
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human EEF1A2 aa 364-462.
    Sequence:

    HTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVE SFSQYPPLGRFAVRDMRQTVAVGVIKNVEKKSGGAGKVTKSAQKAQKAG


    Database link: Q05639

  • Positive control

    • EEF1A2 recombinant protein; Human thyroid (diffuse hyperplasia) tissue lysate; PC12, Hela S3 NE and NIH 3T3 cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab194441 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2500. Predicted molecular weight: 50 kDa.

Target

Images

  • Anti-EEF1A2 antibody - C-terminal (ab194441) at 1/2500 dilution + EEF1A2 recombinant protein (immunizing peptide) at 0.2 µg

    Predicted band size: 50 kDa
    Observed band size: 37 kDa
    why is the actual band size different from the predicted?



    The observed band size may not correspond to the predicted protein molecular weight as the immunogen (recombinant fragment) was used for the test lane.

  • Anti-EEF1A2 antibody - C-terminal (ab194441) at 1/1000 dilution + Human thyroid (diffuse hyperplasia) tissue lysate at 50 µg

    Predicted band size: 50 kDa

  • Anti-EEF1A2 antibody - C-terminal (ab194441) at 1/1000 dilution + PC12 cell lysate at 50 µg

    Predicted band size: 50 kDa

  • Anti-EEF1A2 antibody - C-terminal (ab194441) at 1/1000 dilution + Hela S3 NE cell lysate at 50 µg

    Predicted band size: 50 kDa

  • Anti-EEF1A2 antibody - C-terminal (ab194441) at 1/1000 dilution + NIH 3T3 cell lysate at 50 µg

    Predicted band size: 50 kDa

References

This product has been referenced in:

  • Gandin V  et al. Degradation of newly synthesized polypeptides by ribosome-associated RACK1/c-Jun N-terminal kinase/eukaryotic elongation factor 1A2 complex. Mol Cell Biol 33:2510-26 (2013). WB ; Human . Read more (PubMed: 23608534) »
  • Scaggiante B  et al. Dissecting the expression of EEF1A1/2 genes in human prostate cancer cells: the potential of EEF1A2 as a hallmark for prostate transformation and progression. Br J Cancer 106:166-73 (2012). WB ; Human . Read more (PubMed: 22095224) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194441.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up