Overview

  • Product name

  • Description

    Rabbit polyclonal to EEN
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human EEN aa 219-368.
    Sequence:

    VDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEP EQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFE PENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEVLVPLPQ


    Database link: Q99961

  • Positive control

    • IHC-P: Human colon cancer and placenta tissues.
  • General notes

     This product was previously labelled as SH3 containing Grb 2 like 1 protein

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230043 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Implicated in endocytosis. May recruit other proteins to membranes with high curvature.
  • Tissue specificity

    Ubiquitous. Higher expression in pancreas, placenta, prostate, testis and uterus.
  • Involvement in disease

    Note=In some cases of acute leukemia, a translocation results in the formation of a MLL-EEN fusion gene.
  • Sequence similarities

    Belongs to the endophilin family.
    Contains 1 BAR domain.
    Contains 1 SH3 domain.
  • Domain

    An N-terminal amphipathic helix, the BAR domain and a second amphipathic helix inserted into helix 1 of the BAR domain (N-BAR domain) induce membrane curvature and bind curved membranes.
  • Cellular localization

    Cytoplasm. Early endosome membrane. Associated with postsynaptic endosomes in hippocampal neurons.
  • Information by UniProt
  • Database links

  • Alternative names

    • CNSA1 antibody
    • EEN antibody
    • EEN fusion partner of MLL antibody
    • Endophilin-2 antibody
    • Endophilin-A2 antibody
    • Extra 11 19 leukemia fusion gene antibody
    • Extra eleven-nineteen leukemia fusion gene protein antibody
    • Fusion partner of MLL antibody
    • MGC111371 antibody
    • SH3 containing Grb 2 like 1 protein antibody
    • SH3 containing protein EEN antibody
    • SH3 domain GRB2 like 1 antibody
    • SH3 domain protein 2B antibody
    • SH3 domain-containing GRB2-like protein 1 antibody
    • SH3D2B antibody
    • SH3G1_HUMAN antibody
    • Sh3gl1 antibody
    • SH3P8 antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for EEN using ab230043 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human placenta tissue stained for EEN using ab230043 at 1/100 dilution in immunohistochemical analysis.

References

ab230043 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230043.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up