Overview

  • Product name

    Anti-EFCAB7 antibody
  • Description

    Rabbit polyclonal to EFCAB7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human EFCAB7 aa 1-158.
    Sequence:

    MAISPRSDATFSSQKSTPSESPRTKKFPLTEEEIFYMNCRAAYLTVFKSS LENIISKDQLYLALQHAGRNPSQKTINKYWTPQTAKLNFDDFCIILRKEK PTSKAELLKSFKQLDVNDDGCILHTDLYKFLTKRGEKMTREEVNAIINLA DVNADGKF


    Database link: A8K855

  • Positive control

    • WB: HEK-293 whole cell lysate; Mouse skeletal muscle lysate. IHC-P: Human liver cancer and kidney tissues. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229979 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.
WB 1/2000 - 1/10000. Detects a band of approximately 72 kDa (predicted molecular weight: 72 kDa).

Target

Images

  • All lanes : Anti-EFCAB7 antibody (ab229979) at 1/2000 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 2 : Mouse skeletal muscle tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 72 kDa
    Observed band size: 72 kDa

  • Paraffin-embedded human liver cancer tissue stained for EFCAB7 using ab229979 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for EFCAB7 using ab229979 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for EFCAB7 (green) using ab229979 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).

References

ab229979 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229979.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up