Overview

  • Product name

  • Description

    Rabbit polyclonal to EGF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Pig
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Pig EGF aa 45-275. (Expressed in E.coli).
    Sequence:

    APFLIFSHGNSIFRIDLEGTNHEQLVADAGISVLMDFHYNEERIYWVDLE RQLLQRVFLNGTRQEKVCNLEKNVSGMAINWINEELIWSNQQEGTITVTD MKGNNSRVLLSALKYPANVAVDPVERLMFWSSVVAGSLHRADVTGVEVRL LLETSEEIAAVSLDVLDKRLFWIQYNREGGSSRICSCDYDGGSVHFSKHL TQHNVFAMSLFGDHIFYSTWKKKTIWVANKH


    Database link: Q00968

  • Positive control

    • WB: Porcine uterus lysate; Recombinant porcine EGF protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231103 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 134 kDa.

Target

  • Function

    EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro (PubMed:10964941).
  • Tissue specificity

    Expressed in kidney, salivary gland, cerebrum and prostate.
  • Involvement in disease

    Hypomagnesemia 4
  • Sequence similarities

    Contains 9 EGF-like domains.
    Contains 9 LDL-receptor class B repeats.
  • Post-translational
    modifications

    O-glycosylated with core 1-like and core 2-like glycans. It is uncertain if Ser-954 or Thr-955 is O-glycosylated. The modification here shows glycan heterogeneity: HexHexNAc (major) and Hex2HexNAc2 (minor).
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Beta urogastrone antibody
    • beta-urogastrone antibody
    • EGF antibody
    • EGF_HUMAN antibody
    • Epidermal growth factor antibody
    • HOMG4 antibody
    • OTTHUMP00000219721 antibody
    • OTTHUMP00000219722 antibody
    • Pro epidermal growth factor antibody
    • URG antibody
    • Urogastrone antibody
    see all

Images

  • Anti-EGF antibody (ab231103) at 2 µg/ml + Porcine uterus lysate

    Predicted band size: 134 kDa

  • Anti-EGF antibody (ab231103) at 2 µg/ml + Recombinant porcine EGF protein

    Predicted band size: 134 kDa

References

ab231103 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231103.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up