Overview

  • Product name

  • Description

    Rabbit polyclonal to EGFL7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Mouse EGFL7 aa 30-80 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    RVCTVGISGGSISETFVQRVYQPYLTTCDGHRACSTYRTIYRTAYRRSPG V


    Database link: Q9QXT5

  • Positive control

    • Human colon carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203348 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Regulates vascular tubulogenesis in vivo. Inhibits platelet-derived growth factor (PDGF)-BB-induced smooth muscle cell migration and promotes endothelial cells adhesion to the substrate in vitro.
  • Sequence similarities

    Contains 2 EGF-like domains.
    Contains 1 EMI domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • EGF like domain 7 antibody
    • EGF like domain containing protein 7 antibody
    • EGF like domain multiple 7 antibody
    • EGF-like protein 7 antibody
    • EGFL 7 antibody
    • EGFL7 antibody
    • EGFL7_HUMAN antibody
    • Epidermal growth factor like domain protein 7 antibody
    • Epidermal growth factor-like protein 7 antibody
    • MEGF 7 antibody
    • MEGF7 antibody
    • MGC111117 antibody
    • Multiple EGF like domain protein 7 antibody
    • Multiple EGF-like domains protein 7 antibody
    • Multiple epidermal growth factor like domain protein 7 antibody
    • Multiple epidermal growth factor-like domains protein 7 antibody
    • NEU1 antibody
    • NEU1 protein antibody
    • NOTCH4 like protein antibody
    • NOTCH4-like protein antibody
    • RP11 251M1.2 antibody
    • UNQ187/PRO1449 antibody
    • Vascular endothelial statin antibody
    • VE statin antibody
    • VE-statin antibody
    • ZNEU 1 antibody
    • ZNEU1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human colon carcinoma tissue labeling EGFL7 with ab203348 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203348 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203348.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up