Anti-EGFR antibody (ab225693)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-EGFR antibody
See all EGFR primary antibodies -
Description
Rabbit polyclonal to EGFR -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Zebrafish -
Immunogen
Recombinant full length protein corresponding to Zebrafish EGFR aa 21-389.
Sequence:ATPEKKVCQGANNKLTLLGTVEDHYQVLLRMYRNCTVVLENLEITHITEK YDLSFLKSIQEVGGYVLIAVNTVSKIPLENLRIIRGHSLYEDKFALAVLV NYNNSIEQGVKELPLTSLTEILKGGVRFNMNNHLCNVGTIEWADILNMKS LPTIVSHNISYGKNCGKCDPSCFNGSCWGTGPDKCQRMTKVICAEQCSGR CKGPRPIDCCNEHCAAGCTGPRPTDCLACKDFQDEGTCKDACPRLMLYDP NTHQLAPNPYGKYSFGATCIKTCPHNYVVTDHGACVRTCSPGTYEVDEGG VRKCKRCEGLCPKGTTQTDFCFISSLTNVMRLLLVVLVVYRVSAGSKKVL KVHKSGCRNLRPLRSIKKS
Database link: F1RA48
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.03% Proclin
Constituents: 50% Glycerol, PBS -
Concentration information loading...
-
Purity
Protein G purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab225693 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/5000. Detects a band of approximately 43 kDa (predicted molecular weight: 43 kDa). |
Target
-
Function
Receptor tyrosine kinase binding ligands of the EGF family and activating several signaling cascades to convert extracellular cues into appropriate cellular responses. Known ligands include EGF, TGFA/TGF-alpha, amphiregulin, epigen/EPGN, BTC/betacellulin, epiregulin/EREG and HBEGF/heparin-binding EGF. Ligand binding triggers receptor homo- and/or heterodimerization and autophosphorylation on key cytoplasmic residues. The phosphorylated receptor recruits adapter proteins like GRB2 which in turn activates complex downstream signaling cascades. Activates at least 4 major downstream signaling cascades including the RAS-RAF-MEK-ERK, PI3 kinase-AKT, PLCgamma-PKC and STATs modules. May also activate the NF-kappa-B signaling cascade. Also directly phosphorylates other proteins like RGS16, activating its GTPase activity and probably coupling the EGF receptor signaling to the G protein-coupled receptor signaling. Also phosphorylates MUC1 and increases its interaction with SRC and CTNNB1/beta-catenin.
Isoform 2 may act as an antagonist of EGF action. -
Tissue specificity
Ubiquitously expressed. Isoform 2 is also expressed in ovarian cancers. -
Involvement in disease
Lung cancer
Inflammatory skin and bowel disease, neonatal, 2 -
Sequence similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. EGF receptor subfamily.
Contains 1 protein kinase domain. -
Post-translational
modificationsPhosphorylation at Ser-695 is partial and occurs only if Thr-693 is phosphorylated. Phosphorylation at Thr-678 and Thr-693 by PRKD1 inhibits EGF-induced MAPK8/JNK1 activation. Dephosphorylation by PTPRJ prevents endocytosis and stabilizes the receptor at the plasma membrane. Autophosphorylation at Tyr-1197 is stimulated by methylation at Arg-1199 and enhances interaction with PTPN6. Autophosphorylation at Tyr-1092 and/or Tyr-1110 recruits STAT3. Dephosphorylated by PTPN1 and PTPN2.
Monoubiquitinated and polyubiquitinated upon EGF stimulation; which does not affect tyrosine kinase activity or signaling capacity but may play a role in lysosomal targeting. Polyubiquitin linkage is mainly through 'Lys-63', but linkage through 'Lys-48', 'Lys-11' and 'Lys-29' also occurs. Deubiquitination by OTUD7B prevents degradation. Ubiquitinated by RNF115 and RNF126.
Methylated. Methylation at Arg-1199 by PRMT5 stimulates phosphorylation at Tyr-1197. -
Cellular localization
Secreted and Cell membrane. Endoplasmic reticulum membrane. Golgi apparatus membrane. Nucleus membrane. Endosome. Endosome membrane. Nucleus. In response to EGF, translocated from the cell membrane to the nucleus via Golgi and ER. Endocytosed upon activation by ligand. Colocalized with GPER1 in the nucleus of estrogen agonist-induced cancer-associated fibroblasts (CAF). - Information by UniProt
-
Database links
- SwissProt: F1RA48 Zebrafish
-
Alternative names
- Avian erythroblastic leukemia viral (v erb b) oncogene homolog antibody
- Cell growth inhibiting protein 40 antibody
- Cell proliferation inducing protein 61 antibody
see all
Images
-
All lanes : Anti-EGFR antibody (ab225693) at 1/500 dilution
Lane 1 : Zebrafish tissue at 80 µg
Lane 2 : Zebrafish tissue at 40 µg
Lane 3 : Zebrafish tissue at 20 µg
Lane 4 : Zebrafish tissue at 10 µg
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
Developed using the ECL technique.
Predicted band size: 43 kDa
Observed band size: 43 kDa
References
ab225693 has not yet been referenced specifically in any publications.