Overview

  • Product name
    Anti-Egr1 antibody - N-terminal
    See all Egr1 primary antibodies
  • Description
    Rabbit polyclonal to Egr1 - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: Flow Cyt, WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Cow, Xenopus laevis
  • Immunogen

    Synthetic peptide within Human Egr1 aa 16-45 (N terminal) conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    ISDPFGSFPHSPTMDNYPKLEEMMLLSNGA


    Database link: P18146

  • Positive control
    • NIH 3T3 cell lysate; MDA-MB231 cell lysate; WiDr and HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab174509 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/10 - 1/50.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

 

WB 1/50 - 1/100. Predicted molecular weight: 57 kDa.
ICC/IF 1/10 - 1/50.

Target

  • Function
    Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'(EGR-site). Activates the transcription of target genes whose products are required for mitogenesis and differentiation.
  • Sequence similarities
    Belongs to the EGR C2H2-type zinc-finger protein family.
    Contains 3 C2H2-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • AT225 antibody
    • Early growth response 1 antibody
    • Early growth response protein 1 antibody
    • EGR 1 antibody
    • EGR-1 antibody
    • EGR1 antibody
    • EGR1_HUMAN antibody
    • G0S30 antibody
    • KROX 24 antibody
    • KROX24 antibody
    • Nerve growth factor-induced clone A antibody
    • Nerve growth factor-induced protein A antibody
    • NGFI-A antibody
    • NGFIA antibody
    • TIS8 antibody
    • Transcription factor ETR103 antibody
    • Transcription factor Zif268 antibody
    • ZIF 268 antibody
    • ZIF268 antibody
    • Zinc finger protein 225 antibody
    • Zinc finger protein Krox-24 antibody
    • ZNF225 antibody
    see all

Images

  • Anti-Egr1 antibody - N-terminal (ab174509) at 1/50 dilution + NIH 3T3 cell lysate at 35 µg

    Predicted band size: 57 kDa

  • Flow cytometry analysis of WiDr cells labeling Egr1 with ab174509 at 1/10 dilution (right histogram) compared to negative control cells (left histogram). FITC-conjugated goat-anti-rabbit secondary antibodies were used for the analysis.

  • Immunofluorescent analysis of HeLa cells labeling Egr1 with ab174509 at 1/10 dilution, followed by Alexa Fluor 488-conjugated goat anti-rabbit lgG (green). DAPI was used to stain the cell nuclei (blue).

  • Anti-Egr1 antibody - N-terminal (ab174509) at 1/50 dilution + MDA-MB231 cell lysate at 35 µg

    Predicted band size: 57 kDa

References

This product has been referenced in:
  • Minich RR  et al. Early growth response protein 1 regulates promoter activity of a-plasma membrane calcium ATPase 2, a major calcium pump in the brain and auditory system. BMC Mol Biol 18:14 (2017). Read more (PubMed: 28532435) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174509.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up