Overview

  • Product name

  • Description

    Rabbit polyclonal to EGR2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human EGR2 aa 147-403. (Expressed in E.coli).
    Sequence:

    GPLGVCTMSQTQPDLDHLYSPPPPPPPYSGCAGDLYQDPSAFLSAATTST SSSLAYPPPPSYPSPKPATDPGLFPMIPDYPGFFPSQCQRDLHGTAGPDR KPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPRLPG SSSAAAAAAAAAAYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEG CDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEK PFACDYC


    Database link: P11161

  • Positive control

    • WB: Recombinant human EGR2 protein; Pig cerebrum and kidney lysates; HepG2 and U-87 MG cell lysates. IHC-P: Human ovary tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232695 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 50 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Sequence-specific DNA-binding transcription factor. Binds to two specific DNA sites located in the promoter region of HOXA4.
  • Involvement in disease

    Defects in EGR2 are a cause of congenital hypomyelination neuropathy (CHN) [MIM:605253]. Inheritance can be autosomal dominant or recessive. Recessive CHN is also known as Charcot-Marie-Tooth disease type 4E (CMT4E). CHN is characterized clinically by early onset of hypotonia, areflexia, distal muscle weakness, and very slow nerve conduction velocities.
    Defects in EGR2 are a cause of Charcot-Marie-Tooth disease type 1D (CMT1D) [MIM:607678]. CMT1D is a form of Charcot-Marie-Tooth disease, the most common inherited disorder of the peripheral nervous system. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathy or CMT1, and primary peripheral axonal neuropathy or CMT2. Neuropathies of the CMT1 group are characterized by severely reduced nerve conduction velocities (less than 38 m/sec), segmental demyelination and remyelination with onion bulb formations on nerve biopsy, slowly progressive distal muscle atrophy and weakness, absent deep tendon reflexes, and hollow feet.
    Defects in EGR2 are a cause of Dejerine-Sottas syndrome (DSS) [MIM:145900]; also known as Dejerine-Sottas neuropathy (DSN) or hereditary motor and sensory neuropathy III (HMSN3). DSS is a severe degenerating neuropathy of the demyelinating Charcot-Marie-Tooth disease category, with onset by age 2 years. DSS is characterized by motor and sensory neuropathy with very slow nerve conduction velocities, increased cerebrospinal fluid protein concentrations, hypertrophic nerve changes, delayed age of walking as well as areflexia. There are both autosomal dominant and autosomal recessive forms of Dejerine-Sottas syndrome.
  • Sequence similarities

    Belongs to the EGR C2H2-type zinc-finger protein family.
    Contains 3 C2H2-type zinc fingers.
  • Post-translational
    modifications

    Ubiquitinated by WWP2 leading to proteasomal degradation.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • AT591 antibody
    • CMT1D antibody
    • CMT4E antibody
    • DKFZp686J1957 antibody
    • E3 SUMO-protein ligase EGR2 antibody
    • Early growth response 2 antibody
    • Early growth response protein 2 antibody
    • EGR-2 antibody
    • egr2 antibody
    • EGR2_HUMAN antibody
    • FLJ14547 antibody
    • KROX 20 Drosophila homolog antibody
    • Krox 20 homolog Drosophila antibody
    • KROX-20, Drosophila, homolog (early growth response-2) antibody
    • KROX20 antibody
    • Krox20 protein antibody
    • Zinc finger protein Krox-20 antibody
    see all

Images

  • Anti-EGR2 antibody (ab232695) at 2 µg/ml + Recombinant human EGR2 protein

    Predicted band size: 50 kDa

  • Anti-EGR2 antibody (ab232695) at 2 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Predicted band size: 50 kDa

  • Anti-EGR2 antibody (ab232695) at 2 µg/ml + Pig cerebrum lysate

    Predicted band size: 50 kDa

  • Anti-EGR2 antibody (ab232695) at 2 µg/ml + Pig kidney lysate

    Predicted band size: 50 kDa

  • Anti-EGR2 antibody (ab232695) at 2 µg/ml + U-87 MG (human glioblastoma-astrocytoma epithelial cell line) cell lysate

    Predicted band size: 50 kDa

  • Formalin-fixed, paraffin-embedded human overy tissue stained for EGR2 using ab232695 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab232695 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232695.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up