Anti-EGR2 antibody [OTI1F10] (ab156765)
Key features and details
- Mouse monoclonal [OTI1F10] to EGR2
- Suitable for: WB, ICC/IF
- Reacts with: Human, African green monkey
- Isotype: IgG2b
Overview
-
Product name
Anti-EGR2 antibody [OTI1F10]
See all EGR2 primary antibodies -
Description
Mouse monoclonal [OTI1F10] to EGR2 -
Host species
Mouse -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human, African green monkey
Predicted to work with: Pig -
Immunogen
Recombinant fragment corresponding to Human EGR2 aa 156-476. (NP_000390) produced in E.coli.
Sequence:QTQPDLDHLYSPPPPPPPYSGCAGDLYQDPSAFLSAATTSTSSSLAYPPP PSYPSPKPATDPGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDT LRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPRLPGSSSAAAAAA AAAAYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSD ELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGR KFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGGVQPGGTLCS SNSSSLGGGPLAPCSSRTRTP
Database link: P11161-1 -
Positive control
- ICC/IF: COS-7 cells transiently transfected by pCMV6-ENTRY EGR2. WB: Recombinant Human EGR2 protein (ab132968), pCMV6-ENTRY EGR2 cDNA transfected HEK-293T cell lysate.
-
General notes
The clone number has been updated from 1F10 to OTI1F10, both clone numbers name the same clone.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 1% BSA, 50% Glycerol, PBS -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography -
Clonality
Monoclonal -
Clone number
OTI1F10 -
Isotype
IgG2b -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab156765 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500. Predicted molecular weight: 50.1 kDa.
|
|
ICC/IF |
1/100.
|
Notes |
---|
WB
1/500. Predicted molecular weight: 50.1 kDa. |
ICC/IF
1/100. |
Target
-
Function
Sequence-specific DNA-binding transcription factor. Binds to two specific DNA sites located in the promoter region of HOXA4. -
Involvement in disease
Defects in EGR2 are a cause of congenital hypomyelination neuropathy (CHN) [MIM:605253]. Inheritance can be autosomal dominant or recessive. Recessive CHN is also known as Charcot-Marie-Tooth disease type 4E (CMT4E). CHN is characterized clinically by early onset of hypotonia, areflexia, distal muscle weakness, and very slow nerve conduction velocities.
Defects in EGR2 are a cause of Charcot-Marie-Tooth disease type 1D (CMT1D) [MIM:607678]. CMT1D is a form of Charcot-Marie-Tooth disease, the most common inherited disorder of the peripheral nervous system. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathy or CMT1, and primary peripheral axonal neuropathy or CMT2. Neuropathies of the CMT1 group are characterized by severely reduced nerve conduction velocities (less than 38 m/sec), segmental demyelination and remyelination with onion bulb formations on nerve biopsy, slowly progressive distal muscle atrophy and weakness, absent deep tendon reflexes, and hollow feet.
Defects in EGR2 are a cause of Dejerine-Sottas syndrome (DSS) [MIM:145900]; also known as Dejerine-Sottas neuropathy (DSN) or hereditary motor and sensory neuropathy III (HMSN3). DSS is a severe degenerating neuropathy of the demyelinating Charcot-Marie-Tooth disease category, with onset by age 2 years. DSS is characterized by motor and sensory neuropathy with very slow nerve conduction velocities, increased cerebrospinal fluid protein concentrations, hypertrophic nerve changes, delayed age of walking as well as areflexia. There are both autosomal dominant and autosomal recessive forms of Dejerine-Sottas syndrome. -
Sequence similarities
Belongs to the EGR C2H2-type zinc-finger protein family.
Contains 3 C2H2-type zinc fingers. -
Post-translational
modificationsUbiquitinated by WWP2 leading to proteasomal degradation. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 1959 Human
- Entrez Gene: 100038004 Pig
- GenBank: BC035625 Human
- Omim: 129010 Human
- SwissProt: P11161 Human
- SwissProt: A1XSY8 Pig
- Unigene: 1395 Human
-
Alternative names
- AT591 antibody
- CMT1D antibody
- CMT4E antibody
see all
Images
-
All lanes : Anti-EGR2 antibody [OTI1F10] (ab156765) at 1/500 dilution
Lane 1 : pCMV6-ENTRY EGR2 cDNA transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
Lane 2 : pCMV6-ENTRY control cDNA transfected HEK-293T cell lysate
Lysates/proteins at 5 µg per lane.
Predicted band size: 50.1 kDa -
pCMV6-ENTRY EGR2 cDNA transfected COS-7 (African green monkey kidney fibroblast-like cell line) cells stained for EGR2 using ab156765 at a 1/100 dilution in ICC/IF.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab156765 has not yet been referenced specifically in any publications.