Overview

  • Product name

    Anti-EGR2 antibody [OTI1F10]
    See all EGR2 primary antibodies
  • Description

    Mouse monoclonal [OTI1F10] to EGR2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Pig
  • Immunogen

    Recombinant fragment corresponding to Human EGR2 aa 156-476. (NP_000390) produced in E.coli.
    Sequence:

    QTQPDLDHLYSPPPPPPPYSGCAGDLYQDPSAFLSAATTSTSSSLAYPPP PSYPSPKPATDPGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDT LRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPRLPGSSSAAAAAA AAAAYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSD ELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGR KFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGGVQPGGTLCS SNSSSLGGGPLAPCSSRTRTP


    Database link: P11161-1

  • Positive control

    • ICC/IF: COS-7 cells transiently transfected by pCMV6-ENTRY EGR2. WB: Recombinant Human EGR2 protein (ab132968), pCMV6-ENTRY EGR2 cDNA transfected HEK-293T cell lysate.
  • General notes

    The clone number has been updated from 1F10 to OTI1F10, both clone numbers name the same clone.

Properties

Applications

Our Abpromise guarantee covers the use of ab156765 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500. Predicted molecular weight: 50.1 kDa.
ICC/IF 1/100.

Target

  • Function

    Sequence-specific DNA-binding transcription factor. Binds to two specific DNA sites located in the promoter region of HOXA4.
  • Involvement in disease

    Defects in EGR2 are a cause of congenital hypomyelination neuropathy (CHN) [MIM:605253]. Inheritance can be autosomal dominant or recessive. Recessive CHN is also known as Charcot-Marie-Tooth disease type 4E (CMT4E). CHN is characterized clinically by early onset of hypotonia, areflexia, distal muscle weakness, and very slow nerve conduction velocities.
    Defects in EGR2 are a cause of Charcot-Marie-Tooth disease type 1D (CMT1D) [MIM:607678]. CMT1D is a form of Charcot-Marie-Tooth disease, the most common inherited disorder of the peripheral nervous system. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathy or CMT1, and primary peripheral axonal neuropathy or CMT2. Neuropathies of the CMT1 group are characterized by severely reduced nerve conduction velocities (less than 38 m/sec), segmental demyelination and remyelination with onion bulb formations on nerve biopsy, slowly progressive distal muscle atrophy and weakness, absent deep tendon reflexes, and hollow feet.
    Defects in EGR2 are a cause of Dejerine-Sottas syndrome (DSS) [MIM:145900]; also known as Dejerine-Sottas neuropathy (DSN) or hereditary motor and sensory neuropathy III (HMSN3). DSS is a severe degenerating neuropathy of the demyelinating Charcot-Marie-Tooth disease category, with onset by age 2 years. DSS is characterized by motor and sensory neuropathy with very slow nerve conduction velocities, increased cerebrospinal fluid protein concentrations, hypertrophic nerve changes, delayed age of walking as well as areflexia. There are both autosomal dominant and autosomal recessive forms of Dejerine-Sottas syndrome.
  • Sequence similarities

    Belongs to the EGR C2H2-type zinc-finger protein family.
    Contains 3 C2H2-type zinc fingers.
  • Post-translational
    modifications

    Ubiquitinated by WWP2 leading to proteasomal degradation.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • AT591 antibody
    • CMT1D antibody
    • CMT4E antibody
    • DKFZp686J1957 antibody
    • E3 SUMO-protein ligase EGR2 antibody
    • Early growth response 2 antibody
    • Early growth response protein 2 antibody
    • EGR-2 antibody
    • egr2 antibody
    • EGR2_HUMAN antibody
    • FLJ14547 antibody
    • KROX 20 Drosophila homolog antibody
    • Krox 20 homolog Drosophila antibody
    • KROX-20, Drosophila, homolog (early growth response-2) antibody
    • KROX20 antibody
    • Krox20 protein antibody
    • Zinc finger protein Krox-20 antibody
    see all

Images

  • All lanes : Anti-EGR2 antibody [OTI1F10] (ab156765) at 1/500 dilution

    Lane 1 : pCMV6-ENTRY EGR2 cDNA transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY control cDNA transfected HEK-293T cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 50.1 kDa

  • pCMV6-ENTRY EGR2 cDNA transfected COS-7 (African green monkey kidney fibroblast-like cell line) cells stained for EGR2 using ab156765 at a 1/100 dilution in ICC/IF.

References

ab156765 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156765.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up