Overview

  • Product name

  • Description

    Rabbit polyclonal to EGR3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human EGR3 aa 98-363. (Expressed in E.coli).
    Sequence:

    CQDNIISLMSAGILGVPPASGALSTQTSTASMVQPPQGDVEAMYPALPPY SNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAKPALDSNLFPMIPDYNLY HHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIHPGFGSLP QPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLR IHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDE RKRHAKIHLKQKEKKA


    Database link: Q06889

  • Positive control

    • IHC-P: Human brain tissue. WB: Pig heart lysate; Recombinant human EGR3 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab232820 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 43 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Relevance

    EGR3 is a member of the early growth response transcription factor family of C2H2 zinc finger proteins (other members EGR1, EGR2 and EGR4). EGR proteins are immediate early proteins, expression of which is swiftly upregulated in response to a wide range of extracellular stimuli. EGR3 is also thought to be involved in development of muscle spindles, and is upregulated in several regions of the brain in response to stress or injury.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • Early growth response 3 antibody
    • Early growth response gene 3 antibody
    • Early growth response protein 3 antibody
    • Early growth responsive 3 antibody
    • EGR 3 antibody
    • MGC138484 antibody
    • Pilot antibody
    • Zinc finger protein pilot antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human brain tissue stained for EGR3 using ab232820 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-EGR3 antibody (ab232820) at 2 µg/ml + Recombinant human EGR3 protein

    Predicted band size: 43 kDa

  • Anti-EGR3 antibody (ab232820) at 2 µg/ml + Pig heart lysate

    Predicted band size: 43 kDa

References

ab232820 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232820.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up