Overview

  • Product name
  • Description
    Rabbit polyclonal to EGR4
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ELISA, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide within Human EGR4 aa 524-573 (C terminal). The exact sequence is proprietary.
    Sequence:

    RSDHLTSHVRTHTGEKPFACDVCGRRFARSDEKKRHSKVHLKQKARAEER


    Database link: Q05215

  • Positive control
    • Jurkat cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab50636 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.

Peptide ELISA titre: 1/312500.

WB Use a concentration of 0.0625 µg/ml. Detects a band of approximately 46 kDa (predicted molecular weight: 51 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance
    EGR4(Early Growth Response protein 4) is a zinc-finger transcription factor that activates the transcription of genes whose products are required for mitogenesis and differentiation. EGR4 is closely related to nerve growth factor-induced clone A (NGFI-A or EGR1), EGR2, and EGR3. These four early response (immediate early) proteins all contain very similar zinc-finger DNA binding domains and five highly homologous subdomains. EGR4 functionally cooperate with NFAT proteins and induce expression of IL2 and TNFalpha. Early growth response proteins (EGR) and nuclear factors of activated T cells (NFAT) form heterodimers and regulate proinflammatory cytokine gene expression.
  • Cellular localization
    Nuclear
  • Database links
  • Alternative names
    • AT133 antibody
    • Early growth response protein 4 antibody
    • Nerve growth factor induced clone C antibody
    • NGFI C antibody
    • NGFIC antibody
    • PAT133 antibody
    see all

Images

  • Anti-EGR4 antibody (ab50636) at 0.0625 µg/ml + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50,000 - 1/100,000 dilution.

    Predicted band size: 51 kDa
    Observed band size: 46 kDa
    why is the actual band size different from the predicted?



    The primary antibody was diluted in 5% skim milk/PBS buffer.

References

ab50636 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab50636.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up