Overview

  • Product name

  • Description

    Rabbit polyclonal to EHD2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human EHD2 aa 401-543.
    Sequence:

    ELESTEVGVQGGAFEGTHMGPFVERGPDEAMEDGEEGSDDEAEWVVTKDK SKYDEIFYNLAPADGKLSGSKAKTWMVGTKLPNSVLGRIWKLSDVDRDGM LDDEEFALASHLIEAKLEGHGLPANLPRRLVPPSKRRHKGSAE


    Database link: Q9NZN4

  • Positive control

    • WB: HeLa whole cell lysate (ab150035); Mouse liver and kidney lysates. IHC-P: Human kidney tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222888 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 62, 47 kDa (predicted molecular weight: 61, 46 kDa).
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Plays a role in membrane reorganization in response to nucleotide hydrolysis. Binds to liposomes and deforms them into tubules. Plays a role in membrane trafficking between the plasma membrane and endosomes. Important for the internalization of GLUT4. Required for normal fusion of myoblasts to skeletal muscle myotubes. Binds ATP; does not bind GTP.
  • Tissue specificity

    Highly expressed in heart and moderately expressed in placenta, lung, and skeletal muscle.
  • Sequence similarities

    Contains 1 EF-hand domain.
    Contains 1 EH domain.
  • Domain

    The EH domain interacts with Asn-Pro-Phe (NPF) motifs of target proteins.
  • Cellular localization

    Cell membrane. Endosome membrane. Colocalizes with GLUT4 in intracellular tubulovesicular structures that are associated with cortical F-actin.
  • Information by UniProt
  • Database links

  • Alternative names

    • EH domain containing 2 antibody
    • EH domain containing 3 antibody
    • EH domain containing protein 2 antibody
    • EH domain-containing protein 2 antibody
    • EHD 2 antibody
    • Ehd2 antibody
    • EHD2_HUMAN antibody
    • EHD3 antibody
    • FLJ96617 antibody
    • PAST 2 antibody
    • PAST homolog 2 antibody
    • PAST2 antibody
    see all

Images

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for EHD2 (green) using ab222888 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG (H+L).

  • All lanes : Anti-EHD2 antibody (ab222888) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : Mouse liver lysate
    Lane 3 : Mouse kidney lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 61, 46 kDa
    Observed band size: 47,62 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human kidney tissue stained for EHD2 using ab222888 at 1/100 dilution in immunohistochemical analysis.

References

ab222888 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222888.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up