Anti-EI2BL/MRI1 antibody (ab187894)
Key features and details
- Rabbit polyclonal to EI2BL/MRI1
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-EI2BL/MRI1 antibody -
Description
Rabbit polyclonal to EI2BL/MRI1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Rat, Cow, Cynomolgus monkey -
Immunogen
Recombinant fragment (proprietary-tag) corresponding to Human EI2BL/MRI1 aa 272-361.
Sequence:HGIPFYVAAPSSSCDLRLETGKEIIIEERPGQELTDVNGVRIAAPGIGVW NPAFDVTPHDLITGGIITELGVFAPEELRTALTTTISSRD
Database link: Q9BV20 -
Positive control
- Human thyroid gland tissue; RT-4, U-251MG sp cell lysates; U-2 OS cell line
-
General notes
This product was previously labelled as EI2BL
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab187894 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. | |
WB | Use a concentration of 0.04 - 0.4 µg/ml. | |
IHC-P | 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Catalyzes the interconversion of methylthioribose-1-phosphate (MTR-1-P) into methylthioribulose-1-phosphate (MTRu-1-P). Independently from catalytic activity, promotes cell invasion in response to constitutive RhoA activation by promoting FAK tyrosine phosphorylation and stress fiber turnover. -
Pathway
Amino-acid biosynthesis; L-methionine biosynthesis via salvage pathway; L-methionine from S-methyl-5-thio-alpha-D-ribose 1-phosphate: step 1/6. -
Sequence similarities
Belongs to the eIF-2B alpha/beta/delta subunits family. MtnA subfamily. -
Cellular localization
Nucleus. Cytoplasm. Cell projection. Primarily nuclear, but cytoplasmic in cancer cells, with enrichment at leading edge of the plasma membrane in late stage tumor cells. - Information by UniProt
-
Database links
- Entrez Gene: 534734 Cow
- Entrez Gene: 84245 Human
- Entrez Gene: 288912 Rat
- Omim: 615105 Human
- SwissProt: Q2NL31 Cow
- SwissProt: Q9BV20 Human
- SwissProt: Q5HZE4 Rat
- Unigene: 439370 Human
see all -
Alternative names
- EI2BL antibody
- M1Pi antibody
- Mediator of RhoA-dependent invasion antibody
see all
Images
-
All lanes : Anti-EI2BL/MRI1 antibody (ab187894) at 1/1000 dilution
Lane 1 : RT-4 cell lysate
Lane 2 : U-251MG sp cell lysate -
Immunofluorescent analysis of Human cell line U-2 OS labeling EI2BL/MRI1 with ab187894 at 4µg/ml.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-EI2BL/MRI1 antibody (ab187894)
Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded Human thyroid gland tssue labeling EI2BL/MRI1 with ab187894 at 1/1000 dilution.
-
Immunofluorescent analysis of Human cell line U-2 OS labeling EI2BL/MRI1 with ab187894 at 4µg/ml.
Protocols
Datasheets and documents
References (0)
ab187894 has not yet been referenced specifically in any publications.