Overview

  • Product name

    Anti-EIF1AX antibody
  • Description

    Rabbit polyclonal to EIF1AX
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human EIF1AX aa 10-144.
    Sequence:

    KNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLC HIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGEL PEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI


    Database link: P47813

  • Positive control

    • IHC-P: Human breast cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238498 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    This gene encodes an essential eukaryotic translation initiation factor. The protein is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA.
  • Database links

  • Alternative names

    • EIF1A antibody
    • eIF1A X isoform antibody
    • EIF1AP1 antibody
    • EIF4C antibody
    • Eukaryotic translation initiation factor 1A X chromosomal antibody
    • Eukaryotic translation initiation factor 4C antibody
    see all

Images

  • Paraffin-embedded human breast cancer tissue stained for EIF1AX with ab238498 at a 1/100 dilution in immunohistochemical analysis.

References

ab238498 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238498.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up