Overview

  • Product name

  • Description

    Rabbit polyclonal to EIF2B1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human EIF2B1 aa 1-305.
    Sequence:

    MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLT SAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELF LRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSV YVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGV VENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKF KYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDEL IKLYL


    Database link: Q14232

  • Positive control

    • WB: MCF7, K562, Jurkat and A431 whole cell lysates; Mouse liver and brain tissue lysates. IHC-P: Human prostate cancer and breast cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab229704 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 34 kDa.

Target

  • Function

    Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.
  • Involvement in disease

    Defects in EIF2B1 are a cause of leukodystrophy with vanishing white matter (VWM) [MIM:603896]. VWM is a leukodystrophy that occurs mainly in children. Neurological signs include progressive cerebellar ataxia, spasticity, inconstant optic atrophy and relatively preserved mental abilities. The disease is chronic-progressive with, in most individuals, additional episodes of rapid deterioration following febrile infections or minor head trauma. While childhood onset is the most common form of the disorder, some severe forms are apparent at birth. A severe, early-onset form seen among the Cree and Chippewayan populations of Quebec and Manitoba is called Cree leukoencephalopathy. Milder forms may not become evident until adolescence or adulthood. Some females with milder forms of the disease who survive to adolescence exhibit ovarian dysfunction. This variant of the disorder is called ovarioleukodystrophy.
  • Sequence similarities

    Belongs to the eIF-2B alpha/beta/delta subunits family.
  • Information by UniProt
  • Database links

  • Alternative names

    • EI2BA_HUMAN antibody
    • eIF-2B GDP-GTP exchange factor subunit alpha antibody
    • EIF2B antibody
    • Eif2b1 antibody
    • EIF2BA antibody
    • Eukaryotic translation initiation factor 2B subunit 1 alpha 26kDa antibody
    • Eukaryotic translation initiation factor 2B subunit alpha antibody
    • Translation initiation factor eIF-2B subunit alpha antibody
    see all

Images

  • All lanes : Anti-EIF2B1 antibody (ab229704) at 1/1000 dilution

    Lane 1 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 2 : K562 (human chronic myelogenous leukemia cell line from bone marrow ) whole cell lysate
    Lane 3 : Mouse liver tissue lysate
    Lane 4 : Mouse brain tissue lysate
    Lane 5 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 6 : A431 (human epidermoid carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat anti-rabbit IgG at 1/10000 dilution

    Predicted band size: 34 kDa
    Observed band size: 34 kDa

  • Paraffin-embedded human prostate cancer tissue stained for EIF2B1 using ab229704 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human breast cancer tissue stained for EIF2B1 using ab229704 at 1/100 dilution in immunohistochemical analysis.

References

ab229704 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229704.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up