Overview

  • Product name

  • Description

    Rabbit polyclonal to eIF2B3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Cow, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human eIF2B3 aa 154-245.
    Sequence:

    QRDFIGVDSTGKRLLFMANEADLDEELVIKGSILQKHPRIRFHTGLVDAH LYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSASSQQG


    Database link: Q9NR50

  • Positive control

    • IHC-P: Human colon tissue. WB: RT4 cell lysate. ICC/IF: U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224458 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 50 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.
  • Involvement in disease

    Defects in EIF2B3 are a cause of leukodystrophy with vanishing white matter (VWM) [MIM:603896]. VWM is a leukodystrophy that occurs mainly in children. Neurological signs include progressive cerebellar ataxia, spasticity, inconstant optic atrophy and relatively preserved mental abilities. The disease is chronic-progressive with, in most individuals, additional episodes of rapid deterioration following febrile infections or minor head trauma. While childhood onset is the most common form of the disorder, some severe forms are apparent at birth. A severe, early-onset form seen among the Cree and Chippewayan populations of Quebec and Manitoba is called Cree leukoencephalopathy. Milder forms may not become evident until adolescence or adulthood. Some females with milder forms of the disease who survive to adolescence exhibit ovarian dysfunction. This variant of the disorder is called ovarioleukodystrophy.
  • Sequence similarities

    Belongs to the eIF-2B gamma/epsilon subunits family.
  • Information by UniProt
  • Database links

  • Form

    It localizes to the cytosol.
  • Alternative names

    • EI2BG_HUMAN antibody
    • EIF 2B antibody
    • eIF 2B GDP GTP exchange factor subunit gamma antibody
    • eIF-2B GDP-GTP exchange factor subunit gamma antibody
    • eIF2B-gamma antibody
    • Eif2b3 antibody
    • EIF2Bgamma antibody
    • Eukaryotic translation initiation factor 2B subunit 3 gamma antibody
    • Eukaryotic translation initiation factor 2B, gamma antibody
    • eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa antibody
    • OTTHUMP00000010262 antibody
    • OTTHUMP00000010263 antibody
    • Translation initiation factor eIF-2B subunit gamma antibody
    see all

Images

  • Anti-eIF2B3 antibody (ab224458) at 1/100 dilution + RT4 (human urinary bladder cancer cell line) cell lysate

    Predicted band size: 50 kDa

  • Paraffin embedded human colon tissue stained for eIF2B3 with ab224458 (1/200 dilution) in immunohistochemical analysis.

  • PFA-fixed/Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for eIF2B3 (green) using ab224458 (4 µg/ml) in ICC/IF.

References

ab224458 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224458.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up