Overview

  • Product name

    Anti-EIF2G/EIF2S3 antibody
    See all EIF2G/EIF2S3 primary antibodies
  • Description

    Rabbit polyclonal to EIF2G/EIF2S3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Zebrafish, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human EIF2G/EIF2S3 aa 173-472.
    Sequence:

    HLAAIEIMKLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPII PISAQLKYNIEVVCEYIVKKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVD DLKGGVAGGSILKGVLKVGQEIEVRPGIVSKDSEGKLMCKPIFSKIVSLF AEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGAVGALPEIFTELE ISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKA DLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD


    Database link: P41091

  • Positive control

    • WB: HeLa whole cell lysate. IHC-P: Human tonsil and pancreas tissue.
  • General notes

     This product was previously labelled as EIF2G

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab225953 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000.

Target

Images

  • Anti-EIF2G/EIF2S3 antibody (ab225953) at 1/1000 dilution + HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    Goat polyclonal to rabbit at 1/100000 dilution

    Developed using the ECL technique.
  • Paraffin embedded human tonsil tissue stained for EIF2G/EIF2S3 with ab225953 (1/100 dilution) in immunohistochemical analysis.

  • Paraffin embedded human pancreatic tissue stained for EIF2G/EIF2S3 with ab225953 (1/100 dilution) in immunohistochemical analysis.

References

ab225953 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225953.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up