For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    eif3d-antibody-ab220053.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling DNA / RNA Translation Regulation
Share by email

Anti-EIF3D antibody (ab220053)

  • Datasheet
Reviews (2) Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunocytochemistry/ Immunofluorescence - Anti-EIF3D antibody (ab220053)

    Key features and details

    • Rabbit polyclonal to EIF3D
    • Suitable for: ICC/IF
    • Reacts with: Human
    • Isotype: IgG

    You may also be interested in

    Secondary
    Product image
    Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

    View more associated products

    Overview

    • Product name

      Anti-EIF3D antibody
      See all EIF3D primary antibodies
    • Description

      Rabbit polyclonal to EIF3D
    • Host species

      Rabbit
    • Tested applications

      Suitable for: ICC/IFmore details
    • Species reactivity

      Reacts with: Human
      Predicted to work with: Mouse, Rat, Cow, Xenopus laevis, Zebrafish, Cynomolgus monkey, Orangutan, Xenopus tropicalis
    • Immunogen

      Recombinant fragment corresponding to Human EIF3D aa 286-370.
      Sequence:

      FDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERY NFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDID


      Database link: O15371
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • Positive control

      • A431 cells.
    • General notes

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
    • Storage buffer

      pH: 7.20
      Preservative: 0.02% Sodium azide
      Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine)
    • Concentration information loading...
    • Purity

      Immunogen affinity purified
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Epigenetics and Nuclear Signaling
      • DNA / RNA
      • Translation
      • Regulation
      • Epigenetics and Nuclear Signaling
      • RNAi
      • Eukaryotic Initiation factors (eIF's)

    Associated products

    • Compatible Secondaries

      • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
      • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
    • Isotype control

      • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)

    Applications

    Our Abpromise guarantee covers the use of ab220053 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    ICC/IF Use a concentration of 0.25 - 2 µg/ml.

    Target

    • Function

      Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of posttermination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation.
    • Sequence similarities

      Belongs to the eIF-3 subunit D family.
    • Post-translational
      modifications

      Phosphorylated upon DNA damage, probably by ATM or ATR.
    • Cellular localization

      Cytoplasm.
    • Target information above from: UniProt accession O15371 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 515226 Cow
      • Entrez Gene: 8664 Human
      • Entrez Gene: 55944 Mouse
      • Entrez Gene: 100172951 Orangutan
      • Entrez Gene: 362952 Rat
      • Entrez Gene: 380279 Xenopus laevis
      • Entrez Gene: 394672 Xenopus tropicalis
      • Entrez Gene: 336498 Zebrafish
      • Omim: 603915 Human
      • SwissProt: Q3T122 Cow
      • SwissProt: Q4R8R4 Cynomolgus monkey
      • SwissProt: O15371 Human
      • SwissProt: O70194 Mouse
      • SwissProt: Q5R925 Orangutan
      • SwissProt: Q6AYK8 Rat
      • SwissProt: Q7ZTM9 Xenopus laevis
      • SwissProt: Q6P8G0 Xenopus tropicalis
      • SwissProt: Q6TH15 Zebrafish
      • Unigene: 55682 Human
      • Unigene: 3955 Mouse
      • Unigene: 475286 Mouse
      • Unigene: 3463 Rat
      • Unigene: 6607 Xenopus laevis
      • Unigene: 20756 Zebrafish
      see all
    • Alternative names

      • eIF 3 zeta antibody
      • eIF-3-zeta antibody
      • eIF3 p66 antibody
      • eIF3 zeta antibody
      • eIF3d antibody
      • EIF3D_HUMAN antibody
      • eIF3p66 antibody
      • EIF3S7 antibody
      • Eukaryotic translation initiation factor 3 subunit 7 antibody
      • Eukaryotic translation initiation factor 3 subunit 7 zeta 66/67kDa antibody
      • Eukaryotic translation initiation factor 3 subunit D antibody
      • MGC126526 antibody
      • MGC17258 antibody
      • OTTHUMP00000197900 antibody
      • OTTHUMP00000197901 antibody
      • Translation initiation factor eIF3 p66 subunit antibody
      see all

    Images

    • Immunocytochemistry/ Immunofluorescence - Anti-EIF3D antibody (ab220053)
      Immunocytochemistry/ Immunofluorescence - Anti-EIF3D antibody (ab220053)

      Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized A431 cells labeling EIF3D with ab220053 at 4 µg/ml (green).

    Protocols

    • Immunocytochemistry & immunofluorescence protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab220053? Please let us know so that we can cite the reference in this datasheet.

    ab220053 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-2 of 2 Abreviews or Q&A

    Western blot abreview for Anti-EIF3D antibody

    Good
    Abreviews
    Abreviews
    abreview image
    Application
    Western blot
    Sample
    Drosophila melanogaster Cell lysate - whole cell (S2 cell)
    Gel Running Conditions
    Reduced Denaturing (4–20% Mini-PROTEAN® TGX™ Gel)
    Loading amount
    10000 cells
    Specification
    S2 cell
    Blocking step
    BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 25°C
    Read More

    Abcam user community

    Verified customer

    Submitted Feb 05 2018

    Immunocytochemistry/ Immunofluorescence abreview for Anti-EIF3D antibody

    Good
    Abreviews
    Abreviews
    abreview image
    Application
    Immunocytochemistry/ Immunofluorescence
    Sample
    Drosophila melanogaster Cell (S2 cell)
    Permeabilization
    Yes - 0.1% Triton
    Specification
    S2 cell
    Blocking step
    BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 25°C
    Fixative
    Paraformaldehyde
    Read More

    Abcam user community

    Verified customer

    Submitted Feb 05 2018

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.