Anti-EIF3D antibody (ab220053)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-EIF3D antibody
See all EIF3D primary antibodies -
Description
Rabbit polyclonal to EIF3D -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow, Xenopus laevis, Zebrafish, Cynomolgus monkey, Orangutan, Xenopus tropicalis
-
Immunogen
Recombinant fragment corresponding to Human EIF3D aa 286-370.
Sequence:FDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERY NFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDID
Database link: O15371 -
Positive control
- A431 cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab220053 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
Target
-
Function
Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of posttermination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. -
Sequence similarities
Belongs to the eIF-3 subunit D family. -
Post-translational
modificationsPhosphorylated upon DNA damage, probably by ATM or ATR. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 515226 Cow
- Entrez Gene: 8664 Human
- Entrez Gene: 55944 Mouse
- Entrez Gene: 100172951 Orangutan
- Entrez Gene: 362952 Rat
- Entrez Gene: 380279 Xenopus laevis
- Entrez Gene: 394672 Xenopus tropicalis
- Entrez Gene: 336498 Zebrafish
see all -
Alternative names
- eIF 3 zeta antibody
- eIF-3-zeta antibody
- eIF3 p66 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-EIF3D antibody (ab220053)Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized A431 cells labeling EIF3D with ab220053 at 4 µg/ml (green).
Datasheets and documents
References
ab220053 has not yet been referenced specifically in any publications.
