Anti-EIF3D antibody (ab220053)
Key features and details
- Rabbit polyclonal to EIF3D
- Suitable for: ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-EIF3D antibody
See all EIF3D primary antibodies -
Description
Rabbit polyclonal to EIF3D -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow, Xenopus laevis, Zebrafish, Cynomolgus monkey, Orangutan, Xenopus tropicalis -
Immunogen
Recombinant fragment corresponding to Human EIF3D aa 286-370.
Sequence:FDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERY NFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDID
Database link: O15371 -
Positive control
- A431 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab220053 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. |
Target
-
Function
Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of posttermination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. -
Sequence similarities
Belongs to the eIF-3 subunit D family. -
Post-translational
modificationsPhosphorylated upon DNA damage, probably by ATM or ATR. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 515226 Cow
- Entrez Gene: 8664 Human
- Entrez Gene: 55944 Mouse
- Entrez Gene: 100172951 Orangutan
- Entrez Gene: 362952 Rat
- Entrez Gene: 380279 Xenopus laevis
- Entrez Gene: 394672 Xenopus tropicalis
- Entrez Gene: 336498 Zebrafish
see all -
Alternative names
- eIF 3 zeta antibody
- eIF-3-zeta antibody
- eIF3 p66 antibody
see all
Images
Protocols
Datasheets and documents
References (0)
ab220053 has not yet been referenced specifically in any publications.