
  • Product name
  • Description
    Rabbit polyclonal to eIF3e
  • Host species
  • Tested applications
    Suitable for: IHC-P, ICC/IF, WB, IPmore details
  • Species reactivity
    Reacts with: Chicken, Human, Zebrafish
    Predicted to work with: Mouse, Rat, Cow, Xenopus laevis
  • Immunogen

    Synthetic peptide conjugated to KLH derived from within residues 50 - 150 of Human eIF3e.

    Read Abcam's proprietary immunogen policy (Peptide available as ab36902.)

  • Positive control
    • Recombinant Human eIF3e protein (ab114769) can be used as a positive control in WB. This antibody gave a positive signal in the following whole cell lysates: HeLa (Human epithelial carcinoma cell line) Jurkat (Human T cell lymphoblast-like cell line) A431 (Human epithelial carcinoma cell line) HEK 293 (Human embryonic kidney cell line) HepG2 (Human hepatocellular liver carcinoma cell line) MCF-7 (Human breast adenocarcinoma cell line) SHSY-5Y (Human neuroblastoma cell line)


  • Form
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.02% Sodium Azide
    Constituents: 1% BSA, PBS, pH 7.4
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab36766 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 1 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
ICC/IF Use a concentration of 5 µg/ml.
WB Use a concentration of 1 µg/ml. Detects a band of approximately 48 kDa (predicted molecular weight: 52 kDa).
IP Use at an assay dependent concentration.


  • Function
    Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of posttermination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. Required for nonsense-mediated mRNA decay (NMD); may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway. May interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins.
  • Tissue specificity
    Ubiquitously expressed. Expressed at highest levels in appendix, lymph, pancreas, skeletal muscle, spleen and thymus.
  • Sequence similarities
    Belongs to the eIF-3 subunit E family.
    Contains 1 PCI domain.
  • Post-translational
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm. Nucleus > PML body.
  • Information by UniProt
  • Database links
  • Alternative names
    • eIF-3 p48 antibody
    • eIF3e antibody
    • EIF3E_HUMAN antibody
    • EIF3S6 antibody
    • eIFe antibody
    • Eukaryotic translation initiation factor 3 subunit 6 antibody
    • Eukaryotic translation initiation factor 3 subunit E antibody
    • eukaryotic translation initiation factor 3, subunit 6 (48kD) antibody
    • INT6 antibody
    • mammary tumor-associated protein INT6 antibody
    • murine mammary tumor integration site 6 (oncogene homolog) antibody
    • Viral integration site protein INT-6 homolog antibody
    see all


  • All lanes : Anti-eIF3e antibody (ab36766) at 1 µg/ml

    Lane 1 : HeLa (Human epithelial carcinoma cell line) Whole Cell Lysate
    Lane 2 : Jurkat whole cell lysate (ab7899)
    Lane 3 : A431 whole cell lysate (ab7909)
    Lane 4 : HEK293 whole cell lysate (ab7902)
    Lane 5 : HeLa (Human epithelial carcinoma cell line) Whole Cell Lysate with Human eIF3e peptide (ab36902) at 1 µg/ml
    Lane 6 : Jurkat whole cell lysate (ab7899) with Human eIF3e peptide (ab36902) at 1 µg/ml
    Lane 7 : A431 whole cell lysate (ab7909) with Human eIF3e peptide (ab36902) at 1 µg/ml
    Lane 8 : HEK293 whole cell lysate (ab7902) with Human eIF3e peptide (ab36902) at 1 µg/ml

    Lysates/proteins at 10 µg per lane.

    All lanes : IRDye 680 Conjugated Goat Anti-Rabbit IgG (H+L) at 1/10000 dilution

    Performed under reducing conditions.

    Predicted band size: 52 kDa
    Observed band size: 48 kDa
    why is the actual band size different from the predicted?
    Additional bands at: 40 kDa (possible degradation product)

  • eIF3e was immunoprecipitated using 0.5mg Hela whole cell extract, 5µg of Rabbit polyclonal to eIF3e and 50µl of protein G magnetic beads (+). No antibody was added to the control (-).
    The antibody was incubated under agitation with Protein G beads for 10min, Hela whole cell extract lysate diluted in RIPA buffer was added to each sample and incubated for a further 10min under agitation.
    Proteins were eluted by addition of 40µl SDS loading buffer and incubated for 10min at 70oC; 10µl of each sample was separated on a SDS PAGE gel, transferred to a nitrocellulose membrane, blocked with 5% BSA and probed with ab36766.
    Secondary: Mouse monoclonal [SB62a] Secondary Antibody to Rabbit IgG light chain (HRP) (ab99697).
    Band: 48kDa: eIF3e.
  • ICC/IF image of ab36766 stained human HeLa cells. The cells were methanol fixed (5 min), permabilised in TBS-T (20 min) and incubated with the antibody (ab36766, 5µg/ml) for 1h at room temperature. 1%BSA / 10% normal serum / 0.3M glycine was used to quench autofluorescence and block non-specific protein-protein interactions. The secondary antibody (green) was Alexa Fluor® 488 goat anti-rabbit IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red). DAPI was used to stain the cell nuclei (blue).

  • IHC image of ab36766 staining in pancreas formalin fixed paraffin embedded tissue section, performed on a Leica BondTM system using the standard protocol F. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH6, epitope retrieval solution 1) for 20 mins. The section was then incubated with ab36766, 5µg/ml, for 15 mins at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.

    For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.

  • All lanes : Anti-eIF3e antibody (ab36766) at 1/1000 dilution

    Lane 1 : Chicken tectum lysate
    Lane 2 : Zebrafish lysate

    Lysates/proteins at 5 µg per lane.

    All lanes : HRP-conjugated goat anti-rabbit polyclonal IgG
    at 1/10000 dilution

    Predicted band size: 52 kDa
    Observed band size: 48 kDa why is the actual band size different from the predicted?
    Additional bands at: 38 kDa (possible degradation product)

    See Abreview


This product has been referenced in:
  • Xu F  et al. Up-regulation Of EIF3e Is Associated with The Progression of Esophageal Squamous Cell Carcinoma and Poor Prognosis in Patients. J Cancer 9:1135-1144 (2018). Read more (PubMed: 29675094) »
  • Li Q  et al. Int6/eIF3e Silencing Promotes Placenta Angiogenesis in a Rat Model of Pre-eclampsia. Sci Rep 8:8944 (2018). IHC-P ; Rat . Read more (PubMed: 29895936) »
See all 6 Publications for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Abcam guarantees this product to work in the species/application used in this Abreview.
Western blot
Chicken Cell lysate - whole cell (Tectum)
Loading amount
5 µg
Gel Running Conditions
Reduced Denaturing (10% Bis-Tris gel)
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C

Abcam user community

Verified customer

Submitted Nov 28 2012


Thank you for contacting us. As far as we know, there are no publications in which this antibody was used. We add publications as soon as we learn of them through our search service or the researchers themselves. We began offering this antibody April, 2007. The immunogen is a 17 aa peptide found within the following sequence: IVKMFEDPETTRQMQSTRDGRMLFDYLADK I hope this information helps. Please do not hesitate to contact us if you have any other questions.

Read More


Sign up