Anti-eIF4B antibody (ab171820)
Key features and details
- Mouse polyclonal to eIF4B
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-eIF4B antibody
See all eIF4B primary antibodies -
Description
Mouse polyclonal to eIF4B -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse -
Immunogen
Full length protein corresponding to Human eIF4B aa 1-611.
Sequence:MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVSKPVSWADETDDLEGD VSTTWHSNDDDVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFL GNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFEDLDSL LSALSLNEESLGNRRIRVDVADQAQDKDRDDRSFGRDRNRDSDKTDTDWR ARPATDSFDDYPPRRGDDSFGDKYRDRYDSDRYRDGYRDGYRDGPCRDMD RYGGRDRYDDRGSRDYDRGYDSRIGSGRRAFGSGYRRDDDYRGGGDRYED RYDRRDDRSWSSRDDYSRDDYRRDDRGPPQRPKLNLKPRSTPKEDDSSAS TSQSTRAASIFGGAKPVDTAAREREVEERLQKEQEKLQRQLDEPKLERRP RERHPSWRSEETQERERSRTGSESSQTGTSTTSSRNARRRESEKSLENET LNKEEDCHSPTSKPPKPDQPLKVMPAPPPKENAWVKRSSNPPARSQSSDT EQQSPTSGGGKVAPAQPSEEGPGRKDENKVDGMNAPKGQTGNSSRGPGDG GNRDHWKESDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSVDG EDENEGEDYAE
Database link: AAH98437.1 -
Positive control
- eIF4B-transfected 293T cell lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab171820 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 69 kDa. |
Target
-
Function
Required for the binding of mRNA to ribosomes. Functions in close association with EIF4-F and EIF4-A. Binds near the 5'-terminal cap of mRNA in presence of EIF-4F and ATP. Promotes the ATPase activity and the ATP-dependent RNA unwinding activity of both EIF4-A and EIF4-F. -
Sequence similarities
Contains 1 RRM (RNA recognition motif) domain. -
Post-translational
modificationsPhosphorylated at Ser-422 by RPS6KA1 and RPS6KB1; phosphorylation enhances the affinity of EIF4B for the EIF3 complex. - Information by UniProt
-
Database links
- Entrez Gene: 1975 Human
- Entrez Gene: 75705 Mouse
- Omim: 603928 Human
- SwissProt: P23588 Human
- SwissProt: Q8BGD9 Mouse
- Unigene: 648394 Human
- Unigene: 702041 Human
- Unigene: 290022 Mouse
see all -
Alternative names
- 2310046H11Rik antibody
- AL024095 antibody
- C85189 antibody
see all
Images
-
All lanes : Anti-eIF4B antibody (ab171820) at 1 µg/ml
Lane 1 : eIF4B-transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Secondary
All lanes : Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution
Developed using the ECL technique.
Predicted band size: 69 kDa
Datasheets and documents
References (0)
ab171820 has not yet been referenced specifically in any publications.