Overview

  • Product name

    Anti-EIF4E1B antibody - N-terminal
    See all EIF4E1B primary antibodies
  • Description

    Rabbit polyclonal to EIF4E1B - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 20-69 (

    EKEEEAAERTPTGEKSPNSPRTLLSLRGKARTGGPMEVKLELHPLQNRWA

    ) of Human EIF4E1B (NM_001099408).

  • Positive control

    • Human fetal heart lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab136318 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 28 kDa.

Target

  • Cellular localization

    Cytoplasmic; mRNA cap binding complex
  • Database links

  • Alternative names

    • Eukaryotic translation initiation factor 4E family member 1B antibody
    • Eukaryotic translation initiation factor 4E type 1B antibody

Images

  • Anti-EIF4E1B antibody - N-terminal (ab136318) at 1 µg/ml + Human fetal heart lysate at 10 µg

    Secondary
    standard HRP-labelled anti-rabbit

    Predicted band size: 28 kDa

References

ab136318 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab136318.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up