Overview

  • Product name

  • Description

    Rabbit polyclonal to eIF4EBP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant full length protein within Human eIF4EBP1 aa 2-118. The exact sequence is proprietary.
    Sequence:

    SGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTR IIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNS PEDKRAGGEESQFEMDI


    Database link: Q13541

  • Positive control

    • WB: HeLa cell extract; HEK-293T whole cell extract. ICC/IF: HCT 116 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab227540 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/3000. Predicted molecular weight: 13 kDa.
ICC/IF 1/100 - 1/1000.

Target

  • Function

    Regulates eIF4E activity by preventing its assembly into the eIF4F complex. Mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways.
  • Sequence similarities

    Belongs to the eIF4E-binding protein family.
  • Post-translational
    modifications

    Phosphorylated on serine and threonine residues in response to insulin, EGF and PDGF. Phosphorylation at Thr-37, Thr-46, Ser-65 and Thr-70 is regulated by mTORC1. Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4E-BP1 antibody
    • 4EBP1 antibody
    • 4EBP1_HUMAN antibody
    • BP 1 antibody
    • eIF4E binding protein 1 antibody
    • eIF4E-binding protein 1 antibody
    • Eif4ebp1 antibody
    • Eukaryotic translation initiation factor 4E-binding protein 1 antibody
    • PHAS-I antibody
    • PHASI antibody
    • Phosphorylated heat- and acid-stable protein regulated by insulin 1 antibody
    see all

Images

  • All lanes : Anti-eIF4EBP1 antibody (ab227540) at 1/1000 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
    Lane 2 : eIF4EBP1 knockout HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract

    Lysates/proteins at 30 µg per lane.

    Secondary
    All lanes : HRP-conjugated anti-rabbit IgG

    Developed using the ECL technique.

    Predicted band size: 13 kDa



    15% SDS-PAGE gel.

  • Anti-eIF4EBP1 antibody (ab227540) at 1/1000 dilution + HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell extract at 30 µg

    Predicted band size: 13 kDa



    15% SDS-PAGE gel.

  • 4% paraformaldehyde-fixed HCT 116 (human colorectal carcinoma cell line) cells stained for eIF4EBP1 (green) using ab227540 at 1/1000 dilution in ICC/IF.

    Nuclear counterstain: Hoechst 33342 (blue).

References

ab227540 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab227540.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up