Anti-EKLF / KLF1 antibody [1B6A3] (ab175372)
Key features and details
- Mouse monoclonal [1B6A3] to EKLF / KLF1
- Suitable for: WB, Flow Cyt, IHC-P
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-EKLF / KLF1 antibody [1B6A3]
See all EKLF / KLF1 primary antibodies -
Description
Mouse monoclonal [1B6A3] to EKLF / KLF1 -
Host species
Mouse -
Tested applications
Suitable for: WB, Flow Cyt, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human EKLF/ KLF1 aa 208-362. Expressed in E. Coli.
Sequence:PAPQYQGHFQLFRGLQGPAPGPATSPSFLSCLGPGTVGTGLGGTAEDPGV IAETAPSKRGRRSWARKRQAAHTCAHPGCGKSYTKSSHLKAHLRTHTGEK PYACTWEGCGWRFARSDELTRHYRKHTGQRPFRCQLCPRAFSRSDHLALH MKRHL
Database link: Q13351 -
Positive control
- Human EKLF / KLF1 recombinant protein; HeLa cells; Human cervical and rectum cancer tissues
-
General notes
This product was changed from ascites to supernatant. Lot no’s high than GR252532-8 are from Tissue Culture Supernatant
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
1B6A3 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Conjugation kits
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab175372 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/2000. Predicted molecular weight: 38 kDa.
|
|
Flow Cyt |
1/200 - 1/400.
ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
|
IHC-P |
1/200 - 1/1000.
|
Notes |
---|
WB
1/500 - 1/2000. Predicted molecular weight: 38 kDa. |
Flow Cyt
1/200 - 1/400. ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
IHC-P
1/200 - 1/1000. |
Target
-
Function
Transcription regulator of erythrocyte development that probably serves as a general switch factor during erythropoiesis. Is a dual regulator of fetal-to-adult globin switching. Binds to the CACCC box in the beta-globin gene promoter and acts as a preferential activator of this gene. Furthermore, it binds to the BCL11A promoter and activates expression of BCL11A, which in turn represses the HBG1 and HBG2 genes. This dual activity ensures that, in most adults, fetal hemoglobin levels are low. Able to activate CD44 and AQP1 promoters. When sumoylated, acts as a transcriptional repressor by promoting interaction with CDH2/MI2beta and also represses megakaryocytic differentiation. -
Tissue specificity
Expression restricted to adult bone marrow and fetal liver. Not expressed in myeloid nor lymphoid cell lines. -
Involvement in disease
Defects in KLF1 are the cause of congenital dyserythropoietic anemia type 4 (CDA4) [MIM:613673]. It is a blood disorder characterized by ineffective erythropoiesis and hemolysis resulting in anemia. Circulating erythroblasts and erythroblasts in the bone marrow show various morphologic abnormalities. Affected individuals with CDA4 also have increased levels of fetal hemoglobin. -
Sequence similarities
Belongs to the krueppel C2H2-type zinc-finger protein family.
Contains 3 C2H2-type zinc fingers. -
Post-translational
modificationsAcetylated; can be acetylated on both Lys-274 and Lys-288. Acetylation on Lys-274 (by CBP) appears to be the major site affecting EKLF transactivation activity.
Sumoylated; sumoylation, promoted by PIAS1, leads to repression of megakaryocyte differentiation. Also promotes the interaction with the CDH4 subunit of the NuRD repression complex.
Phosphorylated primarily on serine residues in the transactivation domain. Phosphorylation on Thr-23 is critical for the transactivation activity. -
Cellular localization
Nucleus. Colocalizes with SUMO1 in nuclear speckles. - Information by UniProt
-
Database links
- Entrez Gene: 10661 Human
- Omim: 600599 Human
- SwissProt: Q13351 Human
- Unigene: 37860 Human
-
Alternative names
- CDAN4 antibody
- EKLF antibody
- EKLF PEN antibody
see all
Images
-
Anti-EKLF / KLF1 antibody [1B6A3] (ab175372) at 1/500 dilution + Human EKLF / KLF1 recombinant protein
Predicted band size: 38 kDaExpected MW is 42.6 kDa
-
Immunohistochemical analysis of paraffin-embedded Human rectum cancer tissue labeling EKLF / KLF1 using ab175372 at 1/200 dilution, followed by DAB staining.
-
Immunohistochemical analysis of paraffin-embedded Human cervical cancer tissue labeling EKLF / KLF1 using ab175372 at 1/200 dilution, followed by DAB staining.
-
Flow cytometric analysis of HeLa cells labeling EKLF / KLF1 using ab175372 at 1/200 dilution (green) and negative control (red).
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (2)
ab175372 has been referenced in 2 publications.
- Liang L et al. Deubiquitylase USP7 regulates human terminal erythroid differentiation by stabilizing GATA1. Haematologica N/A:N/A (2019). PubMed: 30872372
- de Vasconcellos JF et al. IGF2BP1 overexpression causes fetal-like hemoglobin expression patterns in cultured human adult erythroblasts. Proc Natl Acad Sci U S A 114:E5664-E5672 (2017). WB ; Human . PubMed: 28652347