Overview

  • Product name
    Anti-EKLF / KLF1 antibody [1B6A3]
    See all EKLF / KLF1 primary antibodies
  • Description
    Mouse monoclonal [1B6A3] to EKLF / KLF1
  • Host species
    Mouse
  • Tested applications
    Suitable for: ELISA, WB, Flow Cyt, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human EKLF/ KLF1 aa 208-362. Expressed in E. Coli.
    Sequence:

    PAPQYQGHFQLFRGLQGPAPGPATSPSFLSCLGPGTVGTGLGGTAEDPGV IAETAPSKRGRRSWARKRQAAHTCAHPGCGKSYTKSSHLKAHLRTHTGEK PYACTWEGCGWRFARSDELTRHYRKHTGQRPFRCQLCPRAFSRSDHLALH MKRHL


    Database link: Q13351

  • Positive control
    • Human EKLF / KLF1 recombinant protein; HeLa cells; Human cervical and rectum cancer tissues
  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR252532-8 are from Tissue Culture Supernatant

Properties

Applications

Our Abpromise guarantee covers the use of ab175372 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/10000.
WB 1/500 - 1/2000. Predicted molecular weight: 38 kDa.
Flow Cyt 1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

IHC-P 1/200 - 1/1000.

Target

  • Function
    Transcription regulator of erythrocyte development that probably serves as a general switch factor during erythropoiesis. Is a dual regulator of fetal-to-adult globin switching. Binds to the CACCC box in the beta-globin gene promoter and acts as a preferential activator of this gene. Furthermore, it binds to the BCL11A promoter and activates expression of BCL11A, which in turn represses the HBG1 and HBG2 genes. This dual activity ensures that, in most adults, fetal hemoglobin levels are low. Able to activate CD44 and AQP1 promoters. When sumoylated, acts as a transcriptional repressor by promoting interaction with CDH2/MI2beta and also represses megakaryocytic differentiation.
  • Tissue specificity
    Expression restricted to adult bone marrow and fetal liver. Not expressed in myeloid nor lymphoid cell lines.
  • Involvement in disease
    Defects in KLF1 are the cause of congenital dyserythropoietic anemia type 4 (CDA4) [MIM:613673]. It is a blood disorder characterized by ineffective erythropoiesis and hemolysis resulting in anemia. Circulating erythroblasts and erythroblasts in the bone marrow show various morphologic abnormalities. Affected individuals with CDA4 also have increased levels of fetal hemoglobin.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 3 C2H2-type zinc fingers.
  • Post-translational
    modifications
    Acetylated; can be acetylated on both Lys-274 and Lys-288. Acetylation on Lys-274 (by CBP) appears to be the major site affecting EKLF transactivation activity.
    Sumoylated; sumoylation, promoted by PIAS1, leads to repression of megakaryocyte differentiation. Also promotes the interaction with the CDH4 subunit of the NuRD repression complex.
    Phosphorylated primarily on serine residues in the transactivation domain. Phosphorylation on Thr-23 is critical for the transactivation activity.
  • Cellular localization
    Nucleus. Colocalizes with SUMO1 in nuclear speckles.
  • Information by UniProt
  • Database links
  • Alternative names
    • CDAN4 antibody
    • EKLF antibody
    • EKLF PEN antibody
    • Erythroid krueppel like transcription factor (EKLF) (Erythroid transcription factor) antibody
    • Erythroid krueppel-like transcription factor antibody
    • Erythroid Kruppel like factor antibody
    • Erythroid specific transcription factor EKLF antibody
    • HBFQTL6 antibody
    • Human erythroid-specific transcription factor EKLF mRNA complete cds antibody
    • INLU antibody
    • Klf1 antibody
    • KLF1_HUMAN antibody
    • Krueppel-like factor 1 antibody
    • Kruppel like factor 1 (erythroid) antibody
    see all

Images

  • Anti-EKLF / KLF1 antibody [1B6A3] (ab175372) at 1/500 dilution + Human EKLF / KLF1 recombinant protein

    Predicted band size: 38 kDa



    Expected MW is 42.6 kDa

  • Immunohistochemical analysis of paraffin-embedded Human rectum cancer tissue labeling EKLF / KLF1 using ab175372 at 1/200 dilution, followed by DAB staining.

  • Immunohistochemical analysis of paraffin-embedded Human cervical cancer tissue labeling EKLF / KLF1 using ab175372 at 1/200 dilution, followed by DAB staining.

  • Flow cytometric analysis of HeLa cells labeling EKLF / KLF1 using ab175372 at 1/200 dilution (green) and negative control (red).

References

This product has been referenced in:
  • de Vasconcellos JF  et al. IGF2BP1 overexpression causes fetal-like hemoglobin expression patterns in cultured human adult erythroblasts. Proc Natl Acad Sci U S A 114:E5664-E5672 (2017). WB ; Human . Read more (PubMed: 28652347) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175372.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up