Overview

  • Product name

    Anti-ELAC2 antibody - C-terminal
    See all ELAC2 primary antibodies
  • Description

    Rabbit polyclonal to ELAC2 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Chimpanzee, Gorilla
  • Immunogen

    Synthetic peptide within Human ELAC2 aa 776-826 (C terminal). The exact sequence is proprietary.
    Sequence:

    EEMEERREKRELRQVRAALLSRELAGGLEDGEPQQKRAHTEEPQAKKVRA Q


    Database link: Q9BQ52

  • Positive control

    • HeLa, 293T, Jurkat, TCMK1 and NIH 3T3 whole cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab205950 was affinity purified using an epitope specific to ELAC2 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab205950 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 92 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function

    Zinc phosphodiesterase, which displays some tRNA 3'-processing endonuclease activity. Probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA.
  • Tissue specificity

    Widely expressed. Highly expressed in heart, placenta, liver, skeletal muscle, kidney, pancreas, testis and ovary. Weakly expressed in brain, lung, spleen, thymus, prostate, small intestine, colon and leukocytes.
  • Involvement in disease

    Defects in ELAC2 may be a cause of susceptibility to prostate cancer (PC) [MIM:176807]. It is a malignancy originating in tissues of the prostate. Most prostate cancers are adenocarcinomas that develop in the acini of the prostatic ducts. Other rare histopathologic types of prostate cancer that occur in approximately 5% of patients include small cell carcinoma, mucinous carcinoma, prostatic ductal carcinoma, transitional cell carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid cystic carcinoma (basaloid), signet-ring cell carcinoma and neuroendocrine carcinoma.
  • Sequence similarities

    Belongs to the RNase Z family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • COXPD17 antibody
    • elaC homolog 2 (E. coli) antibody
    • ElaC homolog protein 2 antibody
    • elaC ribonuclease Z 2 antibody
    • elaC, E. coli, homolog of, 2 antibody
    • ELAC2 antibody
    • ELC2 antibody
    • FLJ10530 antibody
    • FLJ36693 antibody
    • FLJ42848 antibody
    • Heredity prostate cancer protein 2 antibody
    • HPC2 antibody
    • putative prostate cancer susceptibility protein HPC2/ELAC2 antibody
    • Ribonuclease Z 2 antibody
    • Ribonuclease Z, long form antibody
    • Ribonuclease Z2 antibody
    • RNase Z 2 antibody
    • RNase Z2 antibody
    • RNase ZL antibody
    • RNZ2_HUMAN antibody
    • tRNA 3 endonuclease 2 antibody
    • tRNase Z (long form) antibody
    • tRNase Z 2 antibody
    • tRNase Z2 antibody
    • Zinc phosphodiesterase ELAC protein 2 antibody
    see all

Images

  • All lanes : Anti-ELAC2 antibody - C-terminal (ab205950) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : TCMK1 whole cell lysate
    Lane 5 : NIH 3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 92 kDa


    Exposure time: 3 seconds
  • Detection of ELAC2 in immunoprecipitates of 293T whole cell lysates (1 mg for IP, 20% of IP loaded) using ab205950 at 6 µg/mg lysate for IP and 0.4 µg/ml for WB detection (lane 1). Lane 2 represents control IgG IP. Detection: Chemiluminescence with an exposure time of 3 seconds.

References

ab205950 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205950.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up