Overview

  • Product name

  • Description

    Rabbit polyclonal to Elastase-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Mouse Elastase-1 aa 44-259 (N terminal). (Expressed in E.coli).
    Sequence:

    LQYQYGGSWHHTCGGTLIRSNWVMTAAHCVDSPMTYRVVVGEHNLSQNDG TEQYVNVQKIVSHPYWNKNNVVAGYDIALLRLAKSVTLNNYVQLGVLPRE GTILANNSPCYITGWGRTRTNGELAQTLQQAYLPSVSYSICSSSSYWGSS VKNTMVCAGGDGVRSGCQGDSGGPLHCMVNGQYAVHGVTSFVSSMGCNVA RKPTVFTRVSAYISWM


    Database link: Q91X79

  • Positive control

    • WB: Recombinant mouse Elastase-1 protein, Mouse serum. ICH-P: Mouse testis tissue.
  • General notes

     This product was previously labelled as CELA1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231117 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 29 kDa.

Target

  • Function

    Acts upon elastin.
  • Tissue specificity

    Skin; not expressed in pancreas.
  • Sequence similarities

    Belongs to the peptidase S1 family. Elastase subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • CELA 1 antibody
    • CELA1 antibody
    • CELA1_HUMAN antibody
    • Chymotrypsin like elastase family member 1 antibody
    • Chymotrypsin-like elastase family member 1 antibody
    • ELA1 antibody
    • Elastase 1 antibody
    • Elastase 1 pancreatic antibody
    • Elastase-1 antibody
    • OTTHUMP00000236087 antibody
    see all

Images

  • DAB stained, formalin-fixed, paraffin-embedded mouse testis tissue stained for Elastase-1 using ab231117 at 20 µg/mL in immunohistochemical analysis.

  • Anti-Elastase-1 antibody (ab231117) at 1 µg/ml + Mouse serum

    Predicted band size: 29 kDa

  • Anti-Elastase-1 antibody (ab231117) at 1 µg/ml + Recombinant mouse Elastase-1 protein.

    Predicted band size: 29 kDa

References

ab231117 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231117.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up