Overview

  • Product name

  • Description

    Rabbit polyclonal to Elastase-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Cat, Human, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human Elastase-1 aa 40-258. Two N-terminal tags, His-tag and GST-tag. Expressed in E. coli.
    Sequence:

    SGGSRYHTCGGTLIRQNWVMTAAHCVDYQKTFRVVAGDHNLSQNDGTEQY VSVQKIVVHPYWNSDNVAAGYDIALLRLAQSVTLNSYVQLGVLPQEGAIL ANNSPCYITGWGKTKTNGQLAQTLQQAYLPSVDYAICSSSSYWGSTVKNT MVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRKPT VFTQVSAYISWINNVIASN


    Database link: Q9UNI1

  • Positive control

    • WB: Recombinant human Elastase-1 protein; Rat spleen lysate. IHC-P: Human brain tissue.
  • General notes

     This product was previously labelled as CELA1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231120 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 28 kDa.

Target

Images

  • Formalin-fixed, paraffin-embedded human brain tissue stained for Elastase-1 with ab231120 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Elastase-1 antibody (ab231120) at 2 µg/ml + Rat spleen lysate

    Predicted band size: 28 kDa

  • Anti-Elastase-1 antibody (ab231120) at 2 µg/ml + Recombinant human Elastase-1 protein

    Predicted band size: 28 kDa

References

ab231120 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231120.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up