Overview

  • Product name

    Anti-Elastase 3A antibody
  • Description

    Rabbit polyclonal to Elastase 3A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Cow, Human
    Predicted to work with: Rhesus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human Elastase 3A aa 16-270. Full length mature chain, including propeptide, not including signal peptide. Expressed in E. coli. N-terminal His-tag and GST-tag.
    Sequence:

    SGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAP DWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNR SCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRL YTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNG DSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEE TIASH


    Database link: P09093

  • Positive control

    • IHC-P: Human pancreas tissue. WB: Mouse and cow pancreas lysate. Recombinant human Elastase 3A protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232708 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 29 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Relevance

    Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Elastase 3A (ELA3A) is a serine protease which preferentially cleaves proteins after alanine residues. It is secreted from the pancreas as a zymogen and has a digestive function in the intestine. It has very little elastolytic activity.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • CELA3A antibody
    • ELA3 antibody
    • ELA3A antibody
    • Elastase 1 antibody
    • Elastase 3A antibody
    • elastase 3A pancreatic (protease E) antibody
    • Elastase 3A pancreatic antibody
    • Elastase IIIA antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human pancreas tissue stained for Elastase 3A with ab232708 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Elastase 3A antibody (ab232708) at 2 µg/ml + Cow pancreas lysate

    Predicted band size: 29 kDa

  • Anti-Elastase 3A antibody (ab232708) at 2 µg/ml + Mouse pancreas lysate

    Predicted band size: 29 kDa

  • Anti-Elastase 3A antibody (ab232708) at 2 µg/ml + Recombinant human Elastase 3A protein

    Predicted band size: 29 kDa

References

ab232708 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232708.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up