Overview

  • Product name
  • Description
    Rabbit polyclonal to ELF2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ELISA, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog
  • Immunogen

    Synthetic peptide within Human ELF2 aa 163-212 (internal sequence). The exact sequence is proprietary.
    Sequence:

    TSPDSHEPMKKKKVGRKPKTQQSPISNGSPELGIKKKPREGKGNTTYLWE


    Database link: Q15723

  • Positive control
    • WB: Jurkat cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab28726 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/12500.
WB Use a concentration of 0.5 µg/ml. Predicted molecular weight: 64 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance
    The ELF2 gene encodes a protein that physically interacts with AML1 and mediates opposing effects on AML1 mediated transcription of the B cell specific blk gene.
  • Cellular localization
    Nuclear
  • Database links
  • Alternative names
    • E74 like factor 2 antibody
    • E74 like factor 2 ets domain transcription factor antibody
    • ELF 2 antibody
    • Ets domain transcription factor antibody
    • Ets related factor antibody
    • ETS related transcription factor Elf 2 antibody
    • ETS related transcription factor Elf2 antibody
    • EU 32 antibody
    • EU32 antibody
    • HGNC:3317 antibody
    • NERF 1A antibody
    • NERF 1a b antibody
    • NERF 1B antibody
    • NERF 2 antibody
    • NERF antibody
    • NERF1A antibody
    • NERF1a b antibody
    • NERF1B antibody
    • NERF2 antibody
    • New ETS related factor antibody
    see all

Images

  • Anti-ELF2 antibody (ab28726) at 0.5 µg/ml + Jurkat cell lysate

    Secondary
    HRP conjugated anti Rabbit IgG at 1/50000 dilution

    Developed using the ECL technique.

    Predicted band size: 64 kDa
    Observed band size: 50 kDa
    why is the actual band size different from the predicted?



    Gel concentration: 12%.

References

ab28726 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

DISCOUNT CODE: XXXXXXXX
Expiration date: 12/11/2012

I am very pleased to hear you would like to accept our offer and test ab28726 in [Rat]. This code will give you: 1 free [PRIMARY ANTIBODY/PROTEIN] OR VALUE OFF OF ORDER before the expiration date. To redeem this offer, please submit an Abreview for [Rat] and include this code in the “Additional Comments” section so we know the Abreview is for this promotion. Please remember that submission of the Abreview is sufficient for the discount code to become active.
For more information on how to submit an Abreview, please visit the site: www.abcam.com/Abreviews.

Remember, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways: 1) Call to place your order and mention the code to our customer service department; 2) Include the code in your fax order; 3) Place your order on the web and enter the promotional code.

Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research.

The terms and conditions applicable to this offer can be found here: www.abcam.com/collaborationdiscount.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up