Overview

  • Product name

  • Description

    Rabbit polyclonal to Elf4/MEF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Elf4/MEF aa 1-200.
    Sequence:

    MAITLQPSDLIFEFASNGMDDDIHQLEDPSVFPAVIVEQVPYPDLLHLYS GLELDDVHNGIITDGTLCMTQDQILEGSFLLTDDNEATSHTMSTAEVLLN MESPSDILDEKQIFSTSEMLPDSDPAPAVTLPNYLFPASEPDALNRAGDT SDQEGHSLEEKASREESAKKTGKSKKRIRKTKGNRSTSPVTDPSIPIRKK


    Database link: Q99607

  • Positive control

    • IHC-P: Human breast cancer, prostate, and colon cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238573 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Transcriptional activator that binds to DNA sequences containing the consensus 5'-WGGA-3'. Transactivates promoters of the hematopoietic growth factor genes CSF2, IL3, IL8, and of the bovine lysozyme gene. Acts synergistically with RUNX1 to transactivate the IL3 promoter (By similarity). Also transactivates the PRF1 promoter in natural killer (NK) cells. Plays a role in the development and function of NK and NK T-cells and in innate immunity. Controls the proliferation and homing of CD8+ T cells via the Kruppel-like factors KLF4 and KLF2 (By similarity). Controls cell senescence in a p53-dependent manner. Can also promote celular transformation through inhibition of the p16 pathway.
  • Tissue specificity

    Abundantly expressed in the placenta and in a variety of myeloid leukemia cell lines. Moderate levels of expression in heart, lung, spleen, thymus, peripheral blood lymphocytes, ovary and colon. Lower levels of expression in Jurkat T-cells and other T-cell lines and no expression in brain.
  • Involvement in disease

    A chromosomal aberration involving ELF4 is a cause of acute myeloid leukemia (AML). Translocation t(X;21)(q25-26;q22) with ERG.
  • Sequence similarities

    Belongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
  • Cellular localization

    Nucleus > PML body. Accumulation into PML nuclear bodies is mediated by PML.
  • Information by UniProt
  • Database links

  • Alternative names

    • E74-like factor 4 antibody
    • ELF4 antibody
    • ELF4_HUMAN antibody
    • ELFR antibody
    • ETS-related transcription factor Elf-4 antibody
    • ETS-related transcription factor Elf4 antibody
    • MEF antibody
    • Myeloid Elf-1-like factor antibody
    • Myeloid Elf1-like factor antibody
    see all

Images

  • Paraffin-embedded human breast cancer tissue stained for Elf4/MEF using ab238573 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate tissue stained for Elf4/MEF using ab238573 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon cancer tissue stained for Elf4/MEF using ab238573 at 1/100 dilution in immunohistochemical analysis.

References

ab238573 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238573.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up