Overview

  • Product name

  • Description

    Rabbit polyclonal to ELF5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human ELF5 aa 160-215.
    Sequence:

    QDCHSHSRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSE ALAKMW


    Database link: Q9UKW6

  • Positive control

    • ICC/IF: RT4 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222251 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Transcriptionally activator that may play a role in regulating the later stages of keratinocytes terminal differentiation.
    Isoform 2 binds to DNA sequences containing the consensus nucleotide core sequence GGA[AT]. Transcriptionally activates SPRR2A and the parotid gland-specific PSP promoters.
  • Tissue specificity

    Expressed exclusively in tissues with a high content of epithelial cells. Highly expressed in salivary gland, mammary gland, kidney and prostate. Weakly expressed in placenta and lung. Isoform 1 and isoform 2 are differentially expressed in different tissues. In the kidney, only isoform 1 was expressed, while prostate expressed both isoforms, with levels of isoform 2 being higher. Expression is up-regulated during keratinocyte differentiation. Several epithelial carcinoma cell lines showed lack of expression.
  • Sequence similarities

    Belongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
    Contains 1 PNT (pointed) domain.
  • Domain

    The PNT domain acts as a transcriptional activator.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • E74 like factor 5 (ets domain transcription factor) antibody
    • E74 like factor 5 antibody
    • E74-like factor 5 antibody
    • ELF 5 antibody
    • ELF5 antibody
    • ELF5_HUMAN antibody
    • Epithelium restricted ESE 1 related Ets factor antibody
    • Epithelium restricted ESE1 related Ets factor antibody
    • Epithelium specific Ets transcription factor 2 antibody
    • Epithelium-restricted ESE-1-related Ets factor antibody
    • Epithelium-specific Ets transcription factor 2 antibody
    • ESE 2 antibody
    • ESE-2 antibody
    • ESE2 antibody
    • Ets domain TF antibody
    • Ets domain transcription factor antibody
    • ETS related transcription factor Elf 5 antibody
    • ETS related transcription factor Elf5 antibody
    • ETS-related transcription factor Elf-5 antibody
    see all

Images

  • 4% paraformaldehyde-fixed, 0.1% Triton X-100 permeabilized RT4 (human urinary bladder cancer cell line) cells stained for ELF5 (green) using ab222251 at 4 µg/ml in ICC/IF.

References

ab222251 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222251.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up