Overview

  • Product name

    Anti-ELFN2 antibody
  • Description

    Rabbit polyclonal to ELFN2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human ELFN2 aa 693-812.
    Sequence:

    GIHHLEVKPAYHCSEHRHSFPALYYEEGADSLSQRVSFLKPLTRSKRDST YSQLSPRHYYSGYSSSPEYSSESTHKIWERFRPYKKHHREEVYMAAGHAL RKKVQFAKDEDLHDILDYWK


    Database link: Q5R3F8

  • Positive control

    • IHC: Human cerebellum tissue. WB: U-2 OS cell lysate. ICC: A431 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224037 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 90 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    ELFN2 contains 1 fibronectin type III domain and 5 LRR (leucine rich) repeats. The exact function of ELFN2 remains unknown.
  • Cellular localization

    Membrane; Single pass membrane protein.
  • Database links

  • Alternative names

    • dJ63G5.3 antibody
    • ELFN 2 antibody
    • ELFN2 antibody
    • Extracellular leucine rich repeat and fibronectin type III domain containing 2 antibody
    • KIAA1904 antibody
    • Leucine rich repeat and fibronectin type III domain containing protein 6 antibody
    • Leucine rich repeat containing 62 antibody
    • OTTHUMP00000028829 antibody
    see all

Images

  • Paraffin-embedded human cerebellum tissue stained for ELFN2 using ab224037 at 1/50 dilution in immunohistochemical analysis

  • Anti-ELFN2 antibody (ab224037) at 1/100 dilution + U-2 OS (human bone osteosarcoma epithelial cell line) whole cell lysate

    Predicted band size: 90 kDa

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for ELFN2 (green) using ab224037 at 4 µg/ml in ICC/IF

References

ab224037 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224037.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up