Anti-ELMOD1 antibody (ab229748)
Key features and details
- Rabbit polyclonal to ELMOD1
- Suitable for: IHC-P, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-ELMOD1 antibody
See all ELMOD1 primary antibodies -
Description
Rabbit polyclonal to ELMOD1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Recombinant fragment corresponding to Human ELMOD1 aa 183-334.
Sequence:NLQYFAERDATAAQQVLSDSLHPKCRDITKEEISKFSKAEWEKKRMDKAI GYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQQTFCYLMH EFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEG
Database link: Q8N336 -
Positive control
- WB: Mouse kidney lysate. IHC-P: Human lung and adrenal gland tissues.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab229748 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. | |
WB | 1/1000 - 1/5000. Detects a band of approximately 39 kDa (predicted molecular weight: 39 kDa). |
Target
-
Sequence similarities
Contains 1 ELMO domain. - Information by UniProt
-
Database links
- Entrez Gene: 55531 Human
- Entrez Gene: 270162 Mouse
- SwissProt: Q8N336 Human
- SwissProt: Q3V1U8 Mouse
- Unigene: 495779 Human
- Unigene: 259791 Mouse
-
Alternative names
- DKFZp547C176 antibody
- ELMD1_HUMAN antibody
- ELMO domain containing 1 antibody
see all
Images
-
Anti-ELMOD1 antibody (ab229748) at 1/1000 dilution + mouse kidney lysate
Secondary
Goat polyclonal to rabbit at 1/10000 dilution
Predicted band size: 39 kDa
Observed band size: 39 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ELMOD1 antibody (ab229748)
Paraffin-embedded human lung tissue stained for ELMOD1 using ab229748 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ELMOD1 antibody (ab229748)
Paraffin-embedded human adrenal gland tissue stained for ELMOD1 using ab229748 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab229748 has not yet been referenced specifically in any publications.