Overview

  • Product name

  • Description

    Rabbit polyclonal to ELMOD2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human ELMOD2 aa 82-200.
    Sequence:

    NINPEKDASFKICMKMCLLQITGYKQLYLDVESVRKRPYDSDNLQHEELL MKLWNLLMPTKKLNARISKQWAEIGFQGDDPKTDFRGMGILGLINLVYFS ENYTSEAHQILSRSNHPKL


    Database link: Q8IZ81

  • Positive control

    • WB: Mouse skeletal muscle tissue lysate. IHC-P: Human testis and adrenal gland tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224732 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Detects a band of approximately 35 kDa (predicted molecular weight: 35 kDa).

Target

  • Function

    Acts as a GTPase-activating protein (GAP) toward guanine nucleotide exchange factors like ARL2, ARL3, ARF1 and ARF6, but not for GTPases outside the Arf family. Regulates IFN-related antiviral responses.
  • Tissue specificity

    Alveolar cells (morphologically type II cells) and alveolar macrophages (at protein level). Expressed in brain, colon, heart, kidney, liver, lung, muscle, placenta, small intestine, spleen, stomach and testis. In lung it is expressed in alveolar macrophages and alveolar walls.
  • Sequence similarities

    Contains 1 ELMO domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • 9830169G11Rik antibody
    • ELMD2_HUMAN antibody
    • ELMO domain containing 2 antibody
    • ELMO domain containing protein 2 antibody
    • ELMO domain-containing protein 2 antibody
    • ELMO/CED 12 domain containing 2 antibody
    • ELMOD2 antibody
    • MGC10084 antibody
    see all

Images

  • Anti-ELMOD2 antibody (ab224732) at 1/500 dilution + mouse skeletal muscle tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 35 kDa
    Observed band size: 35 kDa

  • Paraffin-embedded human testis tissue stained for ELMOD2 with ab224732 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human adrenal gland tissue stained for ELMOD2 with ab224732 at 1/100 dilution in immunohistochemical analysis.

References

ab224732 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224732.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up