Overview

  • Product name

  • Description

    Rabbit polyclonal to Elongin A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse Elongin A aa 76-345. (Expressed in E.coli)
    Sequence:

    VPVERNSEAEDQDFEKNNSRKRPRDALQREEELEGNYQESWKPSGSRSYS PEHRQKKHKKLSEPERPHKVAHSHEKRDERKRCHKVSPPYSSDPESSDYG HVQSPPPSSPHQMYTDLSRSPEEDQEPIISHQKPGKVHSNTFQDRLGVSH LGEQGKGAVSHHKQHRSSHKEKHPADAREDEKISAVSREKSHKASSKEES RRLLSGDSAKEKLPSSVVKKDKDREGSSLKKKFSPALDVASDNHFKKPKH KDSEKAKSDKNKQSVDGVDS


    Database link: Q8CB77

  • Positive control

    • IHC-P: Mouse liver, spleen and vas deferens tissues. WB: Mouse liver and brain lysates; HeLa cell lysate; Recombinant mouse Elongin A protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231586 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231586 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 87 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex).
  • Sequence similarities

    Contains 1 F-box domain.
    Contains 1 TFIIS N-terminal domain.
  • Domain

    The elongin BC complex binding domain is also known as BC-box with the consensus [APST]-L-x(3)-C-x(3)-[AILV].
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Alternative names

    • Ela1 antibody
    • Elo A antibody
    • EloA antibody
    • ELOA1_HUMAN antibody
    • Elongin 110 kDa subunit antibody
    • Elongin-A antibody
    • ElonginA antibody
    • RNA polymerase II transcription factor SIII subunit A1 antibody
    • SIII antibody
    • SIII p110 antibody
    • TCEB 3 antibody
    • Tceb3 antibody
    • TCEB3A antibody
    • Transcription elongation factor B (SIII) polypeptide 3 (110kD) antibody
    • Transcription elongation factor B (SIII) polypeptide 3 antibody
    • Transcription elongation factor B alpha subunit antibody
    • Transcription elongation factor B polypeptide 3 antibody
    see all

Images

  • All lanes : Anti-Elongin A antibody (ab231586) at 3 µg/ml

    Lane 1 : Mouse liver lysate
    Lane 2 : Mouse brain lysate
    Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 87 kDa

  • Anti-Elongin A antibody (ab231586) at 3 µg/ml + Recombinant mouse Elongin A protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbi at 1/2000 dilution

    Predicted band size: 87 kDa

  • Paraffin-embedded mouse vas deferens tissue stained for Elongin A using ab231586 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse spleen tissue stained for Elongin A using ab231586 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse liver tissue stained for Elongin A using ab231586 at 20 µg/ml in immunohistochemical analysis. DAB staining.

References

ab231586 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231586.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up